SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Medtr2g080080.1 from Medicago truncatula

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Medtr2g080080.1
Domain Number 1 Region: 462-753
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.06e-82
Family Protein kinases, catalytic subunit 0.00011
Further Details:      
 
Domain Number 2 Region: 89-210
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 1.44e-18
Family alpha-D-mannose-specific plant lectins 0.0039
Further Details:      
 
Weak hits

Sequence:  Medtr2g080080.1
Domain Number - Region: 354-389
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0029
Family Pan module (APPLE domain) 0.039
Further Details:      
 
Domain Number - Region: 381-501
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0106
Family Legume lectins 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Medtr2g080080.1
Sequence length 787
Comment | G-type lectin S-receptor-like Serine/Threonine-kinase SD2-5 | HC | chr2:33802432-33800069 | 20130731
Sequence
MGTKHWFLSYVVVGLFISTLLIMSKPCLCDIQYIGTISPGMEASPMSFIDEKSKFLVSKD
RNFVFGFVTTVNDNTKFLLAIVHMASSIVLWTANRALPVSNVDNFVFDKKGNAYLQRNGT
VIWSTNTISKTMELQDTGNLVLLGNDDNNTVIWQSFSYPTDTLMPSQDFKEGMKLTSEPS
SNNLTYVLEIKSGDVVLSAGFKTPQTYWTMQNDNRKTINKNGDVVAFANLSDNSWRFYDN
NKSLLWQFIVSDIHASWIAVLGKDGVITFSNLNGTGSNSDASLRIPRDPCGTPEPCDPYG
ICSNNRMCSCPLVLLPSCKPGFASPCDDESKRSVEFLKVDDGLGYFALDFLHPYSNTDLS
SCQTSCLGNCSCLAMFFHRSSGNCFLLDSVGSFQKSDDADSSGYVSYIKVARDGGQRSNK
HIIVVVIVVIITFLILLFMGVLYYKKKKRLPRENSEEENFLENLTGMPIRFRYKDLEVAT
NNFSVKLGQGGFGSVYKGLLPDGTELAVKKLEGIGQGKKEFRAEVSIIGSIHHHNLVRLK
GFCADGNHRLLVYEYMANNSLDKWIFKNKKSEFLLDWDTRFSIALGTAKGLAYLHQECDS
KIVHCDIKPENVLLDDHFIAKVSDFGLAKLMNREESHVFTTLRGTRGYLAPEWITNYAIS
EKSDVYSYGMVLLEIIAGRKNYDPNETSEKFNFPRFAFKMMEEGKMRDIIDSEMKIDDEN
DDRVHCAINVALWCIQEDMSMRPSMTKVVQMLEGLCTVPKPPKSSNEGKTSSSSDAYLSA
VSLSGPR
Download sequence
Identical sequences A0A072VAH2
Medtr2g080080.1 XP_013464762.1.50012

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]