SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Medtr2g081520.7 from Medicago truncatula

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Medtr2g081520.7
Domain Number 1 Region: 480-593
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.34e-26
Family Protein kinases, catalytic subunit 0.0022
Further Details:      
 
Domain Number 2 Region: 66-150,182-212
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 2.22e-24
Family alpha-D-mannose-specific plant lectins 0.0045
Further Details:      
 
Weak hits

Sequence:  Medtr2g081520.7
Domain Number - Region: 340-401
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.00706
Family Pan module (APPLE domain) 0.088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Medtr2g081520.7
Sequence length 599
Comment | S-locus lectin kinase family protein | HC | chr2:34215985-34220149 | 20130731
Sequence
MDSIKVLVYCFLLFHFIPTFNALETIVSGQSIKDNETLISKDGTFEAGFFNFGNSNNQYF
GVWYKNISPKTLVWIANRDVPLGNSSGVLNLTDKGTLVIVDSKEVTIWSSNTSTTTSKPS
LQLLESGNLIVKDEIDPDKILWQSFDLPGDTLLPGMSIRTNLVNGDYKGLVSWRDTQDPA
TGLYSYHIDTNGYPQVVITKGDTLFFRIGSWNGRILSGIPSETLYKAYNFSFVITEKEIS
YGYELLNKSVVSRYLVSSTGQIARYMLSDQTNSWQLFFVGPADSCDNYAICGANSNCDID
KSPVCECLEGFVPKSQANWSLQNWSDGCVRKVKLDCDNNDGFLKHMRMKLPDTSKSWFNK
SMNLEECERFCIRNCSCTAYANLDVRDGGSGCLLWFNNILDVRKLPSGGQDLYIRVADSA
SASELGLNKKKLAGILVGCIVFIAIILIILVVSIHRVRRKKLDKPGKNYDFNLKNHTDNK
ENEEIDIPIFDLSIIANSTNNFSVDNKLGEGGFGPVYKGNLENGQDIAVKRLCNTSGQGP
KEFINEVKLIANLQHRNLVKLIGCCIHDDERLLIYEFMINRSLDYFIFGLRFYILYHLF
Download sequence
Identical sequences A0A072VL26
Medtr2g081520.7 XP_013464795.1.50012

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]