SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Medtr3g019580.3 from Medicago truncatula

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Medtr3g019580.3
Domain Number 1 Region: 489-669
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.88e-54
Family Protein kinases, catalytic subunit 0.00035
Further Details:      
 
Domain Number 2 Region: 91-198
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 6.94e-27
Family alpha-D-mannose-specific plant lectins 0.0072
Further Details:      
 
Weak hits

Sequence:  Medtr3g019580.3
Domain Number - Region: 360-433
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.00196
Family Anti-platelet protein 0.083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Medtr3g019580.3
Sequence length 672
Comment | S-locus lectin kinase family protein | LC | chr3:5527153-5524433 | 20130731
Sequence
MKIMRAIKSNTERMENNNKVLMLMVFCFFFCSMPNLSTQKTFTTIAPNQFMQFGDTLVSA
AGMYEAGFFNFGDPQHQYFGIWYKNISPRTIVWVANRNTPTQNSTAMLKLNDQGSLDIVD
GSKGIIWSSNISRIVVKSVVQLFDSGNLVLRDANNSQNFLWESFDYPGNTFLAGMKLKSN
LVTGPYRYLTSWRNPQDPAEGEYSYRIDMDGFPQLVTVKGARILYRGGPWNGFLFSGSPW
QSLSRVLNFSVVFSDKEVSYQYETLNSSINTRLVLDSNGISQRLQWSDRTQTWEAISSRP
VDQCDPYDTCGINSNCNVDIFPICKCLEGFMPKFQPEWQLSNWASGCVRKTPLNCLDDGD
GFLPYTNMKLPDTSTSWYDKSLSLEECKTMCLKNCSCTAYANSDVRDGGSGCLLWFNNIV
DMRKHPDVGQDIYIRLASSELDHKKNKRNSKLAGTVAGIIGLIVLILVTSVYRKKLGYIK
KLFHKKEDSDLSTIFDFSTITNATNHFSNRNKLGEGGFGPVYKGIMVDGQEIAVKRLAKT
SIQGSEEFKNEVKMMATLQHRNLVKLLGCSIRQDEKLLIYEFMPNRSLDYFIFDTMRSKL
LNWNKRLEIINGIARGLLYLHQDSTQRIIHRDLKTSNILLDIDMIPKISDFGLARSFMGD
EAEANTNRVMGS
Download sequence
Identical sequences A0A072UUL9
XP_013459019.1.50012 Medtr3g019580.3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]