SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Medtr3g031640.1 from Medicago truncatula

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Medtr3g031640.1
Domain Number 1 Region: 496-794
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.83e-73
Family Protein kinases, catalytic subunit 0.00011
Further Details:      
 
Domain Number 2 Region: 72-164
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 1.96e-22
Family alpha-D-mannose-specific plant lectins 0.0038
Further Details:      
 
Weak hits

Sequence:  Medtr3g031640.1
Domain Number - Region: 207-301
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.0942
Family Quinoprotein alcohol dehydrogenase-like 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Medtr3g031640.1
Sequence length 800
Comment | Serine/Threonine kinase, plant-type protein | LC | chr3:26677398-26674996 | 20130731
Sequence
MASSLNFFTFLILFFHFQHSSSFSLSVEKPEQDIIMSPKGTFTAGFYSVGENAYSFAIWF
TQIHKNLNNATVVWMANRDQPVNGKRSTLSLLKTGNLVLTDAGHSNVWSTNTNSSKPLEL
FLYDIGNLVLRERKTNGFILWRSFDFPTDTLLPDQSFTRYMKLVSSKSDNVYSSGFYKLL
FNNDNLLSLLYDGPQVSSIYWPDPWLHSWEARRSSYNNSRVAKLDVLGNFISSDGFTLKT
SDYGTSLQRRLTIDFDGNVRSYSRKHGQEKWSISGQFHQQPFKIHGICGPNSVCINNPRT
GRKCLCVPGYSRIDNQNWSQGCKPNFQLSCNNKTKLETYFQRLPHVEFYGYDYQFKANYT
YKQCKHFCLRMCQCVAFQYRLVRDQGISYCYPKRQLQNGFSSPEFRGSIFLRLPKRKHAF
YNENDIQNGSLVCSRNTGVQQLKRSYIKGKKNGSLNFLLWFATCLGVIEVLCFFIAGCFL
FKNRKHSATNKQGYILAIAPGFREFSYSELKQATKGFSQEIGKGAGGTVYKGLLSDNRVV
AIKRLHEANQGEREFLAEVNIIGMLNHMNLIGMLGYCLAGKHRLLVLEFVEKGSLAENLS
SNALDWGKRYNIALGTAKALAYLHEECLEWILHCDIKPQNILIDSDYRPKIVDFGLSKLL
HRNNLNNSSFSRMRGTRGYMAPEWIFNLPITSKVDVYSYGIVVLEMITGKSPTTCIEITD
DGIVSHNERLVTWIKEKRRKESEVGCWIEQIVDPALGLNYDIVQLKTLAVVALDCVEKEK
DVRPTMSQVVERLQSHQHDS
Download sequence
Identical sequences G7J0Q7
Medtr3g031640.1 XP_003599324.1.50012

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]