SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Medtr3g112490.1 from Medicago truncatula

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Medtr3g112490.1
Domain Number 1 Region: 188-254
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.22e-21
Family DNA-binding domain from rap30 0.0023
Further Details:      
 
Domain Number 2 Region: 14-121
Classification Level Classification E-value
Superfamily Rap30/74 interaction domains 0.00000000000000523
Family Rap30/74 interaction domains 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Medtr3g112490.1
Sequence length 262
Comment | transcription initiation factor IIF beta subunit | HC | chr3:52752265-52747840 | 20130731
Sequence
MEDENSYGGSSGGSNLETSKAERSVWLMKCPVAVAKSWQNHPPSQPLSKVVFSIDPLLPE
DDPAHLQFTMEMSGTEAVNMPKTYSLNMFKDFVPMCIFSETSEGDKVAMEGKVEHKFDMK
PRHENMDDYGKLCRERTKKSMIKNRQVQIIADDRGTHMRPMPGMVGLVSSNFKDKKRTQP
VKQTDTKRTRRDRGELEDIMFKLFERQPNWALKQLVQETDQPAQFLKEILNELCVYNKRG
ANQGTYELKPEYKKSVEDANAE
Download sequence
Identical sequences B7FM96
Medtr3g112490.1 XP_013462187.1.50012

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]