SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Medtr4g081675.1 from Medicago truncatula

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Medtr4g081675.1
Domain Number 1 Region: 485-775
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.35e-80
Family Protein kinases, catalytic subunit 0.0000929
Further Details:      
 
Domain Number 2 Region: 74-184
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 1.83e-26
Family alpha-D-mannose-specific plant lectins 0.004
Further Details:      
 
Weak hits

Sequence:  Medtr4g081675.1
Domain Number - Region: 346-414
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.000294
Family Anti-platelet protein 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Medtr4g081675.1
Sequence length 823
Comment | S-locus lectin kinase family protein | LC | chr4:31730599-31733893 | 20130731
Sequence
MDILVFMIFVSYLLAHSFKLSIAADSLGLSQSISNNNNTLVSQNGRYELGFFTPGNSNKT
YLGIWYKNIPVQKFVWVANRNNPINSTSNHALFLNSTGNLVLTQNNSFVWYTTTNQKQVH
NPVAVLLDSGNLVVKNDGETNQDEYLWQSFDYPSDTLLDGMKLGRNLRNGLDWKLTSWKS
PEDPSVGDVSWGLVLNNYPEYYMMKGNDKIFRLGPWNGLHFSALPEQVSNPFLNYEYVSN
DDEIFFRYSIKINSVISKVVVDQTKQHRYVWNEQEHKWKIYITMPKDLCDSYGLCGPYGN
CMMTQQQVCQCFNGFSPKSPQAWIASDWSQGCVRDKHLSCNRNHTNKDGFVKFQGLKVPD
TTHTLLNVTMSIEECREKCLNNCSCMAYTNSNISGEGSGCVMWFGDLIDIRQFQEGGQDL
YIRMFGAELDNIEEPGHRHKRNWRTAKVASAVILSCGVILVCIYFIFRNQRKTVDKQPDK
SERHVDDLDLPLFDLPTISTATNGFSRNNKIGEGGFGTVYKGKLANDQEIAVKRLSSISG
QGMTEFINEVKLIAKLQHRNLVKLLGCCIQGQQMLIYEYMVNGSLDSFIFDNDKSKLLDW
SKRFHIICGIARGLVYLHQDSRLRIIHRDLKASNVLLDDNLNPKISDFGTARTFGGDQFE
GNTKRIIGTYGYMAPEYAVDGLFSVKSDVFSFGILLLEIICGKRNRAYYHTDGTLNLVGQ
AWAAWKEDRALGLTDSNIDETYVVSEVLRCMHISLLCVQQNPEDRPTMASVILMLGSSEK
ELGEPKEPGFISKNVSSETNSITNPKGCCSSVNEVTISLLDAR
Download sequence
Identical sequences A0A072UP20
XP_013456747.1.50012 Medtr4g081675.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]