SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Medtr4g091690.1 from Medicago truncatula

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Medtr4g091690.1
Domain Number 1 Region: 522-823
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.66e-86
Family Protein kinases, catalytic subunit 0.00011
Further Details:      
 
Domain Number 2 Region: 95-207
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 7.85e-20
Family alpha-D-mannose-specific plant lectins 0.0088
Further Details:      
 
Weak hits

Sequence:  Medtr4g091690.1
Domain Number - Region: 376-439
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.00706
Family Hairpin loop containing domain 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Medtr4g091690.1
Sequence length 857
Comment | G-type lectin S-receptor-like Serine/Threonine-kinase | HC | chr4:36372727-36377088 | 20130731
Sequence
mdsaknifyfvtaknhkhkliihnswflinslilllptfsfcscstdiistdkpirdgel
lvsksktfalgfftpakstsryvgiwynnlpiqtvvwvanrnspindtsgilsidpnenl
vlnhnrstipiwstdvslpqsqrnstrviaqlsdvanlvlminntktvlwesfdhptdtl
lpylkigfnrktnqswflqswktdddpgngaftvkfnsivkpqlfmynhdfpwwrgghwn
gailvgapnmkrdmailnvsfvedddnyvaisynmfdksviarivvqqsgffqiftwnnq
ksqwnrfwseptnqcdnygtcgsnsncdplnfedfkctclpgfepkfprdwyerrdgsgg
cvrkkgasicrngegfikvaslkvpdisvavtkgglsleeceeeclrncsctsyavadvs
nggsgclawygdlmdiqklsdqgqdlfvrvdavelakannhkrskgvlgqkrisailvas
tvaivlllsfvfcrwkktrndkmmrqfnqdsseeengaqsnthpnlpffsfktiitatrd
fshqnklgqggfgsvykgclvngqeiavkrlsknsgqgkeefktevkllvklqhrnlvrl
lgccfekeermlvyeylpnksldffifdqnqrssldwgkrfeiicgiargvlylhqdsrl
kiihrdlkasnvlldaamnpkisdfgmarifgedeiqartkrvvgtygymspeyamegry
stksdvfsfgvllleiiagqrnthcetgrdspnlighvwtlwtegraldivdpelnqfyp
psivmrciqigllcvqenainrpsmlevvfmlcnetplcppqkpaflfngnqdlqessts
gggssineltettisar
Download sequence
Identical sequences G7JSW6
Medtr4g091690.1 XP_003608283.2.50012

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]