SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Medtr7g056537.1 from Medicago truncatula

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Medtr7g056537.1
Domain Number 1 Region: 161-279
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 1.18e-24
Family alpha-D-mannose-specific plant lectins 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Medtr7g056537.1
Sequence length 374
Comment | D-mannose-binding lectin protein | LC | chr7:20094335-20090701 | 20130731
Sequence
MATTTSDAESEVDSDDERKVKYHILIISDKPLNKYENVLEEFIIDGIDRSKLASMIYGVS
INKGEGISFSEETPLKWMKRVHGATETGSNEPQRLSAHSRNKLFGGYTSHDFVTARASYY
CHTHNHIIPIHHTDPENLISKGGNFTFGFFSPTNSTSRYVGIWWKSQSRFIWVANRNQPL
NDSNGIVIIFEDGNLVVLNGKKQVIWSSNVSNIASNTTSRISDFGNLVLQESTTGNNIWQ
SIQQPSDTFLPGMKLSINKRTVFSSNSQQLTSWKSSSNPAIGNFSSSTVERLNILELFIW
NETQPCWRSGPWNGGVFTGIQTMKVAYLNSFQGGDDGEGKILIFYTLSNDKELMIYHLNS
QGRLEETWWDDDKK
Download sequence
Identical sequences A0A072TZT5
Medtr7g056537.1 XP_013448679.1.50012

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]