SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Medtr7g056640.1 from Medicago truncatula

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Medtr7g056640.1
Domain Number 1 Region: 501-810
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 8.36e-81
Family Protein kinases, catalytic subunit 0.00014
Further Details:      
 
Domain Number 2 Region: 93-208
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 4.71e-22
Family alpha-D-mannose-specific plant lectins 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Medtr7g056640.1
Sequence length 835
Comment | G-type lectin S-receptor-like Serine/Threonine-kinase | HC | chr7:20259846-20264760 | 20130731
Sequence
MSYFAQIIQNIIDEMIPRMVEDAFKAEYFFFVERHMQMDFKEYICSQICGLNVGIDTITS
SQFIKDPETLISKDGNFTFGFFSPKNSTNRYVGIWWKSQSTIIWVANRNKLLNDSNGIVT
ISEHGNLVVLNGQKQVVWSSNVSNITTNTSSHFSGFGNLVLLENTTGNILWQSIQQPSDT
FLPNMKVSINKRTGKSLKLTSWKSPSDPSVGNFSCNSVERQNIFEVFIWNETRPCWRSGP
WNRGVFTGIQTMKAAYLNSFQGEDDGEGNIVIFYTLANDREITIYHLNSQGIFEEIWWDD
KNKEMKVTWKSQNTECDVYGLCGEFTSCNSLSSPVCSCLKGFEPRNTREWSRNNWTGGCV
RRRPLQCERISNKTTGFFKLQMVKVPDFAEGLAVAPDKCKILCLENCSCVAYSHHDVIGC
MSWTRNLLDIQQFQSGGLDLYIRLSYVEPNLYKTIFIASTVIIATLIIVICAYITWRRSS
NHPANSSDNIIGEMSQDKLQELLKFDFQKVATATNNFDLSNKLGQGGFGPVYKGKLQDGR
EIAVKRLSRASGQGLDEFMNEIVVICKLQHRNLVRLIGCCVEGDEKMLMYEYMPNKSLDA
FIFDPSKNKLLDWRTRHNIIEGIARGLLYLHRDSRLRIIHRDLKASNVLLDEELNPKISD
FGMARIFGGGEDQANTRRIVGTYGYMSPEYAMQGLFSEKSDVFSFGVLLLEIVIGRRNSS
FYDDEHNLSLLGFVWTQWSEDNILSLIDQEIYDHSHHNYISRCIHIGLLCAQELAKDRPA
MAAVISMLNSETASLPPPSKPAFILRESMLNSKLPEECQNGCSINNVSITDISGR
Download sequence
Identical sequences A0A072TZ74
Medtr7g056640.1 XP_013448710.1.50012

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]