SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Medtr7g058550.1 from Medicago truncatula

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Medtr7g058550.1
Domain Number 1 Region: 494-787
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.01e-73
Family Protein kinases, catalytic subunit 0.00014
Further Details:      
 
Domain Number 2 Region: 79-208
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 1.15e-19
Family alpha-D-mannose-specific plant lectins 0.0041
Further Details:      
 
Weak hits

Sequence:  Medtr7g058550.1
Domain Number - Region: 339-386
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0118
Family Pan module (APPLE domain) 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Medtr7g058550.1
Sequence length 793
Comment | Serine/Threonine kinase, plant-type protein | HC | chr7:21106473-21108909 | 20130731
Sequence
MNNLGLSITVFILVLAFLFQCSSSSSSLRKGSSLLVENPEDNIMSQNGMFSAGFTAIGEN
AYSFAIWFTEPTSLNLNKTIIWMANRDQPVNGKRSKLTLLNTGNIVLFDVSLNNVRSSNT
ASLKPLELHLKDDGNLVLRELQGITILWQSFDSPTDTLLPGQPLTRYTKLVASRSESNHS
TGFYKFYFDDANVLGLHYDGPDISSSYWPKPWLLISQVGRANFNGSRIALLDSFGSFLSS
DNLIFITSDYGTVLQRRMKMDSDGNLRVYSRINVSQNWYVSWQAIYGACIAHGICGDNST
CSYNPKHGRKCSCIPGYRVKNHSDWSYGCEPMFDFTCNRSESTFFEMVNVEFYGYDIHYV
PMSNYSSCEKLCLEDCNCKGFQYGFGVLKGFYKCYTKTQLRNGRHSPFFVGSTYLRLPKG
NTFSKEESSTPSDHVCLVKLQRNFVSESENHYVNFFLWFAAAIGAFEAICIFIVWCSLFR
NRKTNADQHGYHQLAAIGFRKYSYLELKKATKGFSQEIGRGGGGIVYKGLLSDQRHVAVK
RLYNAQQGEGEFLAEVGIIGRLNHMNLIEMWGYCAEGKYRLLVYEYMENGSLAENLSANK
LDWSKRYKIVLSIARVLAYLHEECLEWILHCDIKPQNILLDSNFQPKLADFGLSKLQNRN
NLNNSCISMIRGTRGYMAPEWIFNLPITSKVDVYSYGIVVLEMITGKSPTTGFKIVSGEE
ESDGRLVTWVREKRGSDISWLEEIVDPQIALNYDRSKMEIMAKVALDCVVDERDSRPTMS
KVVEMLQYHGSDV
Download sequence
Identical sequences G7L1A0
Medtr7g058550.1 XP_003622938.1.50012

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]