SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Medtr7g058860.1 from Medicago truncatula

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Medtr7g058860.1
Domain Number 1 Region: 487-789
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.97e-76
Family Protein kinases, catalytic subunit 0.0000957
Further Details:      
 
Domain Number 2 Region: 78-201
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 2.36e-20
Family alpha-D-mannose-specific plant lectins 0.0033
Further Details:      
 
Weak hits

Sequence:  Medtr7g058860.1
Domain Number - Region: 339-389
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.000471
Family Pan module (APPLE domain) 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Medtr7g058860.1
Sequence length 793
Comment | Serine/Threonine kinase, plant-type protein | HC | chr7:21132945-21129877 | 20130731
Sequence
MVFKISHIFLIFFLFPFQCSSHLSSLKKGSSLSVEKHAEDVIVSSKGTFSAGFYQVGNNS
FSFAIWFTEMQNQTPNPANIVWMANREQPVNGKLSKLFLLNNGNILLLDAGQHYTWSSNT
ASDAPLELYLKEDGNLVLRELQGSTILWQSYDFPTNTLLPNQPLTRYTKLVSSRSQSNHS
SGFYKCFFDDNNIIRLDYDGPDVSSTYWPPPWLLSWEAGRFNYNSSRIAFLDSLGKFISS
DNYTFSTYDYGMVMQRRLSMDSDGNIRVYSRKNLSKNWYVSWQVVHDPCTIHGICGANSS
CIYDPNMGKKCSCLPGYKVKNHSDWSYGCEPLFDFTCNRSESTFLKLQGFELFGYDNNFV
QNSTYKICETSCLQDCNCKGFQYTYAEDKGIFQCFTKIQLLNGRYSPSFQGITYLRLPKG
NNFYKQESMSVKDHVSLVHLHKDYARKQTSHLFRLFLWLTIVVGGLELVCFLMVCGFLIK
TRKNSSANQHSYHLTLLGFRRYTYSELKVATKNFSNEIGRGGGGVVYRGTLPDQRDAAIK
RLNEAKQGEGEFLAEVSIIEKLNHMNLIEMWGYCVEGKHRILVYEYMENGSLAENLSSKT
NTLDWTKRYDIALGTARVLAYLHEECLEWILHCDIKPQNILLDSNFQPKLADFGLSKLQN
RNNLDNSSGFSMIRGTRGYMAPEWIFNLPITSKVDVYSYGVVVLEMITGKSPTMMNIEGV
DGEGTYNGRLITWVREKKRSTCWVEQILDPAIGNNYDLSKMEILVRVALDCVEEDRDIRP
TMSQVVEMLQSCE
Download sequence
Identical sequences G7L2A2
XP_003622965.1.50012 Medtr7g058860.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]