SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Medtr7g069480.2 from Medicago truncatula

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Medtr7g069480.2
Domain Number 1 Region: 23-110
Classification Level Classification E-value
Superfamily Chaperone J-domain 1.09e-20
Family Chaperone J-domain 0.00043
Further Details:      
 
Domain Number 2 Region: 177-285
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000000000189
Family Calsequestrin 0.064
Further Details:      
 
Domain Number 3 Region: 417-541
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000323
Family Calsequestrin 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Medtr7g069480.2
Sequence length 552
Comment | DnaJ heat shock amine-terminal domain protein | HC | chr7:25594923-25598737 | 20130731
Sequence
MTLSATTLIVTFAALCFLLQSEAKTIDPYKVLGVDKSASQREIQKAFHKLSLQYHPDKNK
AKGAQEKFAQINNDEQKRKNYDLYGDEKGNPGFEAGHPGGYGGPGGFNFRPGEQQWGRGD
QGGSKSFSFSFGGGSGDSNSFGFGLDDLLGNFFGDFGSSFRSQSSQSGSKSSPKSFKAIN
SNIYNKEIVDEGMTWLLLSYSPSLRGIQHFESIIGEVAGTLQGALKVGSINCEKEVSFCK
ELGVYPRKGPRLFVYSYKENEKGSLVEYGGDLAVKDLKAFCQQHLPMFSKRTDLNQLDQF
STAEKLPRVLLLSTKKNTPVIWRVLSGLYRKRFAFSDVQVHDDSDSRVRKLGVDALPAIL
GWLPNGEKLILKTGVSVKDVKSGVQDLSKILDSFEKVSKKETSSQSKKEQADSEDKHIQL
LSRTNFEALCGERTPVCVIGAFRSSKGREKLESLLTLVSQKSLSRKPNGSGSSKDSISYG
LLDSSKQQSFLNAFDKTGYKSSDKLLIAYKPRKGKFTVFTGEMTVEEVENFISSVLSGDI
PFRETHKKPVLK
Download sequence
Identical sequences A0A072U1A0
XP_013449194.1.50012 Medtr7g069480.2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]