SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Medtr8g465980.1 from Medicago truncatula

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Medtr8g465980.1
Domain Number 1 Region: 474-795
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.86e-82
Family Protein kinases, catalytic subunit 0.00016
Further Details:      
 
Domain Number 2 Region: 73-180
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 4.06e-28
Family alpha-D-mannose-specific plant lectins 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Medtr8g465980.1
Sequence length 809
Comment | S-locus lectin kinase family protein | LC | chr8:23551478-23556765 | 20130731
Sequence
MTIIATIFVISKFLLFFSKFSTAADTISQSESLSDGSTLISKDGTFELGFFSPGNSPNRY
VGIWYKNIPVKTVVWVANRDNPCKDNSSKLIINEEGNLVVLGNNQSLLWSTNTTKMTSIP
IAQLLDNGNLVLKDERDEENFLWQSFDYPDNTILAGMKIGWDKKSGINRGFNAWKNWEDP
SSGNFTSGMRLSIIPEMFIWKDSVEIFRTGPFSNVFALQENPVYSYEFVNNEDEVYYIYT
LKNTSVITILVLNQTLLLRQRLIWIPESKTWNVYQNFPQDRCDDYNICGANGNCVIGGSP
ICKCLDGFKPKSPQQWNAMDWTQGCVRGGNWTCGDESRDGFLKLVKMKVPDTKNCWVNEN
MTLDECKVKCLQNCSCTAYSSLSPKEGSIGCSIWFDDLVDLRGSESGQDLYVRTDTSNID
NKDGRNKKVSFGVPIIVSVVIVMLLAFCVYKRKMNNKAKEKSENDIWMEDQNDVELPFFD
LSTILDATNKFSTDNKLGEGGFGPVYKGILQDGQEIAVKRLSGNSIQGLEEFKSEVILCA
KLQHRNLVKVIGCCIEKDEKILVYEHMSNKGLDSFIFDPIQSKLLDWSTRFNILYGIARG
LLYLHQDSRLRIIHRDLKASNILLDNDMNPKISDFGLARMCGADQIEGKTIRIVGTYGYM
APEYAIDGLFSIKSDVFSFGVLVLELISGLKNRTRTYNQQDHNLIAHAWRLWKEGTIHTL
IDTNLMDTCILHEALRCLQIGLLCLQHLPIDRPNMTSVVVMLSSNSALPQPHEPSYLFSN
VSNEIESSSSEIQISSSINKVTISLLDAR
Download sequence
Identical sequences A0A072TS26
XP_013445632.1.50012 Medtr8g465980.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]