SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Medtr8g465990.3 from Medicago truncatula

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Medtr8g465990.3
Domain Number 1 Region: 491-597
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.69e-29
Family Protein kinases, catalytic subunit 0.0027
Further Details:      
 
Domain Number 2 Region: 76-185
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 2.22e-26
Family alpha-D-mannose-specific plant lectins 0.0069
Further Details:      
 
Weak hits

Sequence:  Medtr8g465990.3
Domain Number - Region: 347-411
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.00129
Family Anti-platelet protein 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Medtr8g465990.3
Sequence length 604
Comment | S-locus lectin kinase family protein | HC | chr8:23563321-23560742 | 20130731
Sequence
MNIDIISFLINLTCILLLPSLKFSIAVDTLDLSQSFTNGMTLVSQGEKFVLGFFSPMNSN
KSYLGIWYKNIPVQTVVWVANGVKPINDSSSGILTLNDTGNLVLKQRDEVVWYTTSQQGS
LNPVAQLLDSGNLVIRGEKETNPEVYLWQSFDYPSDTILPGMKLGWNLRTHTERRMTSWK
SPDDPSPGDLYWGSLLYNYPEQYLMQGTKKYVRVGPWNGLHFSGVPDQKPNNVYAYNFVS
NKDEIYYTYSMLNDSVISRMELNQTDSIYYRYVWSEDQQIWNVMKSLPKDRCDYYRKCGV
YGICTITGSLLCECLSGFSPRSPAAWNSSDWSQGCVRNKPLNCTNKLNDGFVKVKGLKIP
DCSHTWVDQTIGLNECRLKCLNNCSCTAYTNSNITGEGSGCVMWFGDLIDIREFENDGQD
LYIRMDASELGKEGHDGLKKNLISILASIIIASGMLFFGYRLYILRHRITEDSENIELEG
GRGSEDEDDLDLPLLTYSTLVTATDNFSIKNKIGEGGFGPVYKGRLASRQEIAVKRLSSD
SGQGINELKNEVKLIAKLQHRNLVKLLGCCIEEEHRMLVYEYMPNNSLNWLIFGMNISNI
LIPW
Download sequence
Identical sequences A0A072TR17
Medtr8g465990.3 XP_013445635.1.50012

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]