SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|21227098|ref|NP_633020.1| from Methanosarcina mazei Go1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|21227098|ref|NP_633020.1|
Domain Number 1 Region: 6-123
Classification Level Classification E-value
Superfamily CobE/GbiG C-terminal domain-like 5.62e-31
Family CobE/GbiG C-terminal domain-like 0.00028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|21227098|ref|NP_633020.1|
Sequence length 123
Comment cobalamin biosynthesis protein G [Methanosarcina mazei Go1]
Sequence
MDKRLLMILGIGTRRGITREEVLEAVKQALDECGLSLQEITAFASAKLKENERGLLEAGE
FLGIPVNFLPDEVLNSYNPPSSSQASRFGLKGVAEPAALALSEKHELICRKKVYGRVTIA
IAR
Download sequence
Identical sequences Q8PY68
WP_011032945.1.12270 WP_011032945.1.13133 WP_011032945.1.13782 WP_011032945.1.14209 WP_011032945.1.14583 WP_011032945.1.14776 WP_011032945.1.15587 WP_011032945.1.16483 WP_011032945.1.16878 WP_011032945.1.18729 WP_011032945.1.18783 WP_011032945.1.21267 WP_011032945.1.21501 WP_011032945.1.2157 WP_011032945.1.21629 WP_011032945.1.21918 WP_011032945.1.23878 WP_011032945.1.24179 WP_011032945.1.29103 WP_011032945.1.29761 WP_011032945.1.32345 WP_011032945.1.33522 WP_011032945.1.40449 WP_011032945.1.41322 WP_011032945.1.43564 WP_011032945.1.43834 WP_011032945.1.44090 WP_011032945.1.4739 WP_011032945.1.49674 WP_011032945.1.4970 WP_011032945.1.53089 WP_011032945.1.53770 WP_011032945.1.57580 WP_011032945.1.58691 WP_011032945.1.61041 WP_011032945.1.61670 WP_011032945.1.62876 WP_011032945.1.63409 WP_011032945.1.64722 WP_011032945.1.65224 WP_011032945.1.66913 WP_011032945.1.7135 WP_011032945.1.7314 WP_011032945.1.73216 WP_011032945.1.73711 WP_011032945.1.74065 WP_011032945.1.75484 WP_011032945.1.75785 WP_011032945.1.76299 WP_011032945.1.7642 WP_011032945.1.76508 WP_011032945.1.8229 WP_011032945.1.82623 WP_011032945.1.82674 WP_011032945.1.83034 WP_011032945.1.8430 WP_011032945.1.84394 WP_011032945.1.90340 WP_011032945.1.9066 WP_011032945.1.90871 WP_011032945.1.91617 WP_011032945.1.94933 WP_011032945.1.95514 gi|21227098|ref|NP_633020.1| 192952.MM_0996

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]