SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|21227210|ref|NP_633132.1| from Methanosarcina mazei Go1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|21227210|ref|NP_633132.1|
Domain Number 1 Region: 4-279
Classification Level Classification E-value
Superfamily F420-dependent methylenetetrahydromethanopterin dehydrogenase (MTD) 3.53e-123
Family F420-dependent methylenetetrahydromethanopterin dehydrogenase (MTD) 0.000000642
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|21227210|ref|NP_633132.1|
Sequence length 279
Comment F420-dependent methylenetetrahydromethanopterin dehydrogenase [Methanosarcina mazei Go1]
Sequence
MKKMVNIGFIKMGNLGMSQVINLIQDEIAAREGITVRVFGTGAKMAPADAADTESFKQWN
ADFVVIISPNAAAPGPTAAREIWKDVPCIIVSDGPTKKEAREAFEQEGFGYIILPVDPLI
GAKREFLDSVEMASFNADAMKVLSICGVVRLIQEELDKVTEQVASGKSGKDLELPHIFAK
PEKCVEHAGFANPYAKSKALAALHMAEKVAQVNFPACFMLKEIEQVCLTAAAGHEIMGAA
AQLANQAREIEKSNDTVSRMPHAKNGAVLKKVRLYEKPE
Download sequence
Identical sequences A0A0E3PUE4 Q8PXV8
192952.MM_1108 gi|21227210|ref|NP_633132.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]