SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|21227342|ref|NP_633264.1| from Methanosarcina mazei Go1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|21227342|ref|NP_633264.1|
Domain Number 1 Region: 284-569
Classification Level Classification E-value
Superfamily Methyl-coenzyme M reductase alpha and beta chain C-terminal domain 4.71e-146
Family Methyl-coenzyme M reductase alpha and beta chain C-terminal domain 0.0000000000421
Further Details:      
 
Domain Number 2 Region: 5-283
Classification Level Classification E-value
Superfamily Methyl-coenzyme M reductase subunits 7.46e-143
Family Methyl-coenzyme M reductase alpha and beta chain N-terminal domain 0.000000000118
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|21227342|ref|NP_633264.1|
Sequence length 570
Comment methyl-coenzyme M reductase subunit alpha [Methanosarcina mazei Go1]
Sequence
MAADIFSKFKKSMEVKFTQEYGSNQQAGGDITGKTAKFLRLGPEQDARKAEMIKAGKEIA
EKRGIAFYNPMMHSGAPLGQRAITPYTLSGTDIVAEPDDLHYVNNAAMQQMWDDIRRTCI
VGLDMAHETLEKRLGKEVTPETINHYLEVLNHAMPGAAVVQEMMVETHPALVDDCYVKVF
TGDDELADEIDKQYVININKMFSEEQAAQIKASMGKTTWQAIHIPTIVSRTTDGAQTSRW
AAMQIGMSFISAYAMCAGEAAVADLSFAAKHAALVSMGEMLPARRARGPNEPGGLSFGHL
ADIIQTSRVSQDPAKIALEVVGAGCMLYDQIWLGSYMSGGVGFTQYATAAYTDDILDNNT
YYDVDYINDKYNGAANLGTDNKVKATLDVVKDIATESTLYGIETYEKFPTALEDHFGGSQ
RATVLAAASGVACALATGNANAGLSGWYLSMYVHKEAWGRLGFFGFDLQDQCGATNVLSY
QGDEGLPDELRGPNYPNYAMNVGHQGGYAGIAQAAHSGRGDAFTVNPLIKVCFADDLMPF
NFAEPRREFGRGAIREFVPAGERSLIIPAK
Download sequence
Identical sequences A0A0E3RG71 Q8PXH8
192952.MM_1240 gi|21227342|ref|NP_633264.1| WP_011033189.1.49674 WP_011033189.1.90340

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]