SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|21227346|ref|NP_633268.1| from Methanosarcina mazei Go1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|21227346|ref|NP_633268.1|
Domain Number 1 Region: 186-432
Classification Level Classification E-value
Superfamily Methyl-coenzyme M reductase alpha and beta chain C-terminal domain 2.88e-131
Family Methyl-coenzyme M reductase alpha and beta chain C-terminal domain 0.000000000665
Further Details:      
 
Domain Number 2 Region: 1-185
Classification Level Classification E-value
Superfamily Methyl-coenzyme M reductase subunits 1.33e-74
Family Methyl-coenzyme M reductase alpha and beta chain N-terminal domain 0.0000000263
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|21227346|ref|NP_633268.1|
Sequence length 434
Comment methyl-coenzyme M reductase subunit beta [Methanosarcina mazei Go1]
Sequence
MSDTVDIYDDRGKLLESNVDIMSLAPTRNAAIKKIILDTKRSVAVNLAGIQGALASGKMG
GKGRQILGRGLNYDIVGNVDAIAANVKKLVQVDEGDDTNVRVLKGGKSLLIQAPSSRMAA
GADFMAATTVGAAAVTQTLIDMFKTDLYDAPIVKSAVWGSYPQTMDLMGGQVQGILSIPQ
NNEGLGYSLRNIMANHVAAITNRGAMNAAALSSIYEQSGIFEMGGAVGMFERHQLLGLAY
QGLNANNMVYDIVKENGKDGTIGTVIESIVGRAIENNVISVDKTAPSGYKFYKANDVPMW
NAYAAAGTLASTLVNCGAGRAAQNVSSTLLYFNDIIEKETGLPGCDYGKVQGTAVGFSFF
SHSIYGGGGPGVFNGNHVVTRHSRGFAIPCVCAAVALDAGTQMFTIESTSGLIGDVFGSI
DEFRQPIKAVAGAL
Download sequence
Identical sequences A0A0E3PU26 A0A0E3RBS6 A0A0E3RJZ5 A0A0E3RW09 A0A0F8JJU9 Q8PXH4
gi|21227346|ref|NP_633268.1| WP_011033193.1.12270 WP_011033193.1.13133 WP_011033193.1.14209 WP_011033193.1.14583 WP_011033193.1.14776 WP_011033193.1.15587 WP_011033193.1.16483 WP_011033193.1.16878 WP_011033193.1.18729 WP_011033193.1.18783 WP_011033193.1.21267 WP_011033193.1.21501 WP_011033193.1.2157 WP_011033193.1.21629 WP_011033193.1.21918 WP_011033193.1.24179 WP_011033193.1.29103 WP_011033193.1.29761 WP_011033193.1.32345 WP_011033193.1.33522 WP_011033193.1.40449 WP_011033193.1.41322 WP_011033193.1.43564 WP_011033193.1.43834 WP_011033193.1.44090 WP_011033193.1.4739 WP_011033193.1.49674 WP_011033193.1.4970 WP_011033193.1.53089 WP_011033193.1.53770 WP_011033193.1.57580 WP_011033193.1.58691 WP_011033193.1.61041 WP_011033193.1.61670 WP_011033193.1.62876 WP_011033193.1.63409 WP_011033193.1.64722 WP_011033193.1.65224 WP_011033193.1.66913 WP_011033193.1.7135 WP_011033193.1.7314 WP_011033193.1.73216 WP_011033193.1.73711 WP_011033193.1.74065 WP_011033193.1.75484 WP_011033193.1.75785 WP_011033193.1.76299 WP_011033193.1.7642 WP_011033193.1.76508 WP_011033193.1.8229 WP_011033193.1.82623 WP_011033193.1.82674 WP_011033193.1.83034 WP_011033193.1.8430 WP_011033193.1.84394 WP_011033193.1.90340 WP_011033193.1.9066 WP_011033193.1.90871 WP_011033193.1.91617 WP_011033193.1.94933 WP_011033193.1.95514 192952.MM_1244

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]