SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|21227396|ref|NP_633318.1| from Methanosarcina mazei Go1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|21227396|ref|NP_633318.1|
Domain Number 1 Region: 1-76
Classification Level Classification E-value
Superfamily Vng1086c-like 1.31e-26
Family Vng1086c-like 0.00055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|21227396|ref|NP_633318.1|
Sequence length 92
Comment hypothetical protein MM_1294 [Methanosarcina mazei Go1]
Sequence
MHKEELIQLHTYMAQMKRYFERHGVTHEFDDYKALSISPVHIHRSKADHKRAIFILGGEL
ATLMSRDDPIFEEASAHMRDSMNSVIKLIGNN
Download sequence
Identical sequences A0A0F8NKR9 Q8PXC7
gi|21227396|ref|NP_633318.1| 192952.MM_1294 MaR24 WP_011033241.1.12270 WP_011033241.1.13133 WP_011033241.1.13782 WP_011033241.1.14209 WP_011033241.1.14583 WP_011033241.1.14776 WP_011033241.1.15587 WP_011033241.1.16483 WP_011033241.1.16878 WP_011033241.1.18729 WP_011033241.1.18783 WP_011033241.1.21267 WP_011033241.1.21501 WP_011033241.1.2157 WP_011033241.1.21629 WP_011033241.1.21918 WP_011033241.1.23878 WP_011033241.1.24179 WP_011033241.1.29103 WP_011033241.1.29761 WP_011033241.1.32345 WP_011033241.1.33522 WP_011033241.1.40449 WP_011033241.1.41322 WP_011033241.1.43564 WP_011033241.1.43834 WP_011033241.1.44090 WP_011033241.1.4739 WP_011033241.1.49674 WP_011033241.1.4970 WP_011033241.1.53089 WP_011033241.1.53770 WP_011033241.1.57580 WP_011033241.1.58691 WP_011033241.1.61041 WP_011033241.1.61670 WP_011033241.1.62876 WP_011033241.1.63409 WP_011033241.1.63967 WP_011033241.1.64722 WP_011033241.1.65224 WP_011033241.1.66913 WP_011033241.1.7135 WP_011033241.1.7314 WP_011033241.1.73216 WP_011033241.1.73711 WP_011033241.1.74065 WP_011033241.1.75484 WP_011033241.1.75785 WP_011033241.1.76299 WP_011033241.1.7642 WP_011033241.1.76508 WP_011033241.1.8229 WP_011033241.1.82623 WP_011033241.1.82674 WP_011033241.1.83034 WP_011033241.1.8430 WP_011033241.1.84394 WP_011033241.1.90340 WP_011033241.1.9066 WP_011033241.1.90871 WP_011033241.1.91617 WP_011033241.1.94933 WP_011033241.1.95514

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]