SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|21227460|ref|NP_633382.1| from Methanosarcina mazei Go1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|21227460|ref|NP_633382.1|
Domain Number 1 Region: 3-68
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 5.57e-18
Family TRAM domain 0.0000648
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|21227460|ref|NP_633382.1|
Sequence length 68
Comment methyltransferase [Methanosarcina mazei Go1]
Sequence
MFREESGSVPVEEGEVYDVTIQDLARQGDGIARIEGFVIFVPGTKVGDEVRIKIERVLPK
YGFASLVE
Download sequence
Identical sequences A0A0F8NTA6 Q8PX64
192952.MM_1358 gi|21227460|ref|NP_633382.1| WP_011033304.1.12270 WP_011033304.1.13133 WP_011033304.1.13782 WP_011033304.1.14209 WP_011033304.1.14583 WP_011033304.1.14776 WP_011033304.1.15587 WP_011033304.1.16483 WP_011033304.1.16878 WP_011033304.1.18729 WP_011033304.1.18783 WP_011033304.1.21267 WP_011033304.1.21501 WP_011033304.1.2157 WP_011033304.1.21629 WP_011033304.1.21918 WP_011033304.1.23878 WP_011033304.1.24179 WP_011033304.1.29103 WP_011033304.1.29761 WP_011033304.1.32345 WP_011033304.1.33522 WP_011033304.1.40449 WP_011033304.1.41322 WP_011033304.1.43564 WP_011033304.1.43834 WP_011033304.1.44090 WP_011033304.1.4739 WP_011033304.1.49674 WP_011033304.1.4970 WP_011033304.1.53089 WP_011033304.1.53770 WP_011033304.1.57580 WP_011033304.1.58691 WP_011033304.1.61041 WP_011033304.1.61670 WP_011033304.1.62876 WP_011033304.1.63409 WP_011033304.1.64722 WP_011033304.1.65224 WP_011033304.1.66913 WP_011033304.1.7135 WP_011033304.1.7314 WP_011033304.1.73216 WP_011033304.1.73711 WP_011033304.1.74065 WP_011033304.1.75484 WP_011033304.1.75785 WP_011033304.1.76299 WP_011033304.1.7642 WP_011033304.1.76508 WP_011033304.1.8229 WP_011033304.1.82623 WP_011033304.1.82674 WP_011033304.1.83034 WP_011033304.1.8430 WP_011033304.1.84394 WP_011033304.1.90340 WP_011033304.1.9066 WP_011033304.1.90871 WP_011033304.1.91617 WP_011033304.1.94933 WP_011033304.1.95514 MaR31

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]