SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|21227549|ref|NP_633471.1| from Methanosarcina mazei Go1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|21227549|ref|NP_633471.1|
Domain Number 1 Region: 50-244
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 1.93e-16
Family Terpene synthases 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|21227549|ref|NP_633471.1|
Sequence length 246
Comment hypothetical protein MM_1447 [Methanosarcina mazei Go1]
Sequence
MKPEKHRKMLSNLELDIVKNGFSWLSSRQIEPVKELASTVTAHALWGLKNPYVTRLILKK
ECDSWDSSIRDTARACSALSTEGIVFRASEKWLLSRKKGSSWNEDVYDTAYSLGALADME
VPDIEGCNWLYENYGPAWEQAGTTSLIISALKKQEKLTGNRDFEKFIRERAEWVLSKRGQ
DGGWEHISTSNLAIQALILAGFKKELEISIHWLLGKVRESGAWGNKEDDINATALTLSTL
GMYEKT
Download sequence
Identical sequences A0A0E3LGA7 A0A0E3RFQ6 A0A0E3RP76 A0A0E3RY60 A0A0F8QZ79 M1P8T6 Q8PWX9
gi|21227549|ref|NP_633471.1| WP_011033393.1.12270 WP_011033393.1.13133 WP_011033393.1.13782 WP_011033393.1.14209 WP_011033393.1.14583 WP_011033393.1.14776 WP_011033393.1.15587 WP_011033393.1.16878 WP_011033393.1.18729 WP_011033393.1.18783 WP_011033393.1.21267 WP_011033393.1.21501 WP_011033393.1.2157 WP_011033393.1.21629 WP_011033393.1.21918 WP_011033393.1.24179 WP_011033393.1.29103 WP_011033393.1.29761 WP_011033393.1.32345 WP_011033393.1.33522 WP_011033393.1.41322 WP_011033393.1.43564 WP_011033393.1.43834 WP_011033393.1.44090 WP_011033393.1.4739 WP_011033393.1.49674 WP_011033393.1.4970 WP_011033393.1.53089 WP_011033393.1.53770 WP_011033393.1.57580 WP_011033393.1.58691 WP_011033393.1.61041 WP_011033393.1.61670 WP_011033393.1.62876 WP_011033393.1.63409 WP_011033393.1.64722 WP_011033393.1.65224 WP_011033393.1.66913 WP_011033393.1.7135 WP_011033393.1.7314 WP_011033393.1.73216 WP_011033393.1.73711 WP_011033393.1.74065 WP_011033393.1.75484 WP_011033393.1.75785 WP_011033393.1.76299 WP_011033393.1.7642 WP_011033393.1.76508 WP_011033393.1.8229 WP_011033393.1.82623 WP_011033393.1.83034 WP_011033393.1.8430 WP_011033393.1.84394 WP_011033393.1.90340 WP_011033393.1.9066 WP_011033393.1.90871 WP_011033393.1.91617 WP_011033393.1.94933 192952.MM_1447 gi|452210030|ref|YP_007490144.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]