SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|21227968|ref|NP_633890.1| from Methanosarcina mazei Go1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|21227968|ref|NP_633890.1|
Domain Number 1 Region: 93-239
Classification Level Classification E-value
Superfamily Aerolisin/ETX pore-forming domain 0.0000249
Family (Pro)aerolysin, pore-forming lobe 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|21227968|ref|NP_633890.1|
Sequence length 294
Comment hypothetical protein MM_1866 [Methanosarcina mazei Go1]
Sequence
MGIQISIKAGADASTSSVSASGSVQHIITDNERKTFGIEDAGLKSAVEKYFGKKPNDAYL
HSPTPWDDLYKTYGWAEVQTILDVKSSTITGITSEPVIVATKKFVNSSTKVATFDASISD
QVNDTTESNWSETDTIDVGQKITYEVSFLGAGGGGETSMSYSHSWGQGGSESKSITVGSS
SGVTVQLNPGESVEAVLTASRGVMKVRIVYLAHLTGSTAVNYNPTYKDHHFWALPITGVM
GAASLSTTREFTEDIEIGYYSDAKIELRDPTGQLKATFLAANKPAIEKIAVKAV
Download sequence
Identical sequences Q8PVU4
192952.MM_1866 WP_011033801.1.49674 gi|21227968|ref|NP_633890.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]