SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|21228200|ref|NP_634122.1| from Methanosarcina mazei Go1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|21228200|ref|NP_634122.1|
Domain Number 1 Region: 117-188
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000144
Family Cadherin 0.023
Further Details:      
 
Domain Number 2 Region: 280-332
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.00000000373
Family Type I dockerin domain 0.0022
Further Details:      
 
Domain Number 3 Region: 23-95
Classification Level Classification E-value
Superfamily Carbohydrate-binding domain 0.00000126
Family Cellulose-binding domain family III 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|21228200|ref|NP_634122.1|
Sequence length 336
Comment hypothetical protein MM_2098 [Methanosarcina mazei Go1]
Sequence
MASANSVIEGDLFKQKGASTFFNEGDINSSEGTIKHIYGLIIGTSNVSSSGTFATVNLTA
GNKTGMTEFSLSNVLISDINSKSVPYTVTNATVLIDTAPVIDPICCPKSVDEKSKLAFKI
SAKDADGDRLTLSASGLPEGASFNRTSGAFAWTPAVGQTGVYTIAFKVSDGYLTDSENVT
VTVNKLNNPPVIDFFEPINGSSFSEGERIGISVNATDAEKQALNYSIKIDGVMYSSDPAY
IWETDYSSSGNHTIEVSVSDGIDEAKMQHSIYISECHPRYDVNEDGVVNILDITNVSREY
ETTVSKPYPRYDTNQDGEINILDLTLVGHHFGEKVE
Download sequence
Identical sequences Q8PV76
192952.MM_2098 MaR112 gi|21228200|ref|NP_634122.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]