SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000001150 from Anolis carolinensis 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000001150
Domain Number 1 Region: 212-460
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 4.63e-49
Family Voltage-gated potassium channels 0.0013
Further Details:      
 
Domain Number 2 Region: 58-166
Classification Level Classification E-value
Superfamily POZ domain 2.25e-28
Family Tetramerization domain of potassium channels 0.00052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000001150   Gene: ENSACAG00000001221   Transcript: ENSACAT00000001182
Sequence length 517
Comment pep:novel chromosome:AnoCar2.0:4:53002834:53033171:1 gene:ENSACAG00000001221 transcript:ENSACAT00000001182 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALLPGNADPEFTSYTYNNLETYCEVQTKKGFFYKKAKLLHPGEDLYCFACREDRTRYVI
INVGGIKYRIPWTTLENCPLTRLGRLKSCNNYDEIMDICDDYDVNCNEFFFDRNPCAFRT
IMTFLTAGKLRLLREMCALSFQDELVYWGIEEEHLEWCCKKRLRQKEEEMAEAALFEEEM
AAEEVPECAFEDTSRLRLCMRRLRDMVENPHSGIPGKIFACISVSFVAITAVSLCISTMP
DLREEEDRGECSQKCHDIFVLETVCVAWFSFEFILRSIQAESKCAFLKTPLNIIDIMAIL
PFYISLIIDLASTKNTDKPGGGGSVGNKYLERVGLVLRTLRALRILYVMRLARHSLGLQT
LGLTVRRCTREFGLLLLFLCVAMALFSPLVYLAESEMGAKHEFTSVPSSYWWAVISMTTV
GYGDMVPRSIPGQVVALSSILSGILLMAFPVTSIFHTFSRSYIELKEEQQRAASRQLHQA
ENKVPNDDSSQEGDSTCPQGNDGGVLHPETQTETKDC
Download sequence
Identical sequences ENSACAP00000001150

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]