SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000007071 from Anolis carolinensis 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000007071
Domain Number 1 Region: 32-161
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 3.53e-43
Family Regulator of G-protein signaling, RGS 0.00000826
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000007071   Gene: ENSACAG00000007215   Transcript: ENSACAT00000007223
Sequence length 171
Comment pep:novel chromosome:AnoCar2.0:2:195536431:195550540:-1 gene:ENSACAG00000007215 transcript:ENSACAT00000007223 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
WKVKRNLLNRGTESKTNTTGVLTLCFPELKMPTPEEAQEWSDSLEKLLLHPYGRASFHAF
LESEFSEENLDFWMACEEYRKLRGCEKLQENARKIYDEYVTIQAPKEVVNLDSQTRDITN
RNILLPTRSCFEQAQRRIFGLMEKDSYPRFLRSLVYQALVHSNRQQANGPV
Download sequence
Identical sequences ENSACAP00000007071

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]