SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000007378 from Anolis carolinensis 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000007378
Domain Number 1 Region: 11-120
Classification Level Classification E-value
Superfamily SRP19 1.7e-37
Family SRP19 0.00000192
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000007378   Gene: ENSACAG00000007550   Transcript: ENSACAT00000007534
Sequence length 146
Comment pep:novel scaffold:AnoCar2.0:GL343193.1:7004196:7010117:1 gene:ENSACAG00000007550 transcript:ENSACAT00000007534 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KVMAWAASSLPTDKSRFICIYPAYINNKKTIAEGRRIPLDKAIENPTSTEIQDVCVAVGL
NVLLEKNKMYPREWNRDAQYRGRVRIQLKQEDGNPCQPQFPTRKAVMLYAAETIPKLKTR
TQKMGGSDQSLQQGEGGKKGKGKKKK
Download sequence
Identical sequences H9GCR9
ENSACAP00000007378 ENSACAP00000007378

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]