SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000001834 from Anolis carolinensis 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000001834
Domain Number 1 Region: 305-557
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.09e-59
Family Voltage-gated potassium channels 0.00057
Further Details:      
 
Domain Number 2 Region: 179-276
Classification Level Classification E-value
Superfamily POZ domain 1.88e-26
Family Tetramerization domain of potassium channels 0.0000039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000001834   Gene: ENSACAG00000001936   Transcript: ENSACAT00000001878
Sequence length 645
Comment pep:novel chromosome:AnoCar2.0:1:59350772:59352760:-1 gene:ENSACAG00000001936 transcript:ENSACAT00000001878 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEVAMVSAESSGCNSHMPYGYAAQARARERERLAQSSSGGGGGPHHHYHQEQGRGASSSS
CGGNTSHSGYSQNGRRKKHRRKKTRCLGSREFGSSFPCSELLPLSGSEEKILKDLSEEDE
DEEEEEEEDDGEDEEDERKLYYSDEDGEDELSFTDHPPEDGAGPGGYTSVRYSEYECCER
IVINVSGLRFETQMKTLAQFPETLLGDPAKRGRYFDPLRNEYFFDRNRPSFDAILYYYQS
GGRLKRPVNVPFDIFSEEVKFYELGEEAMLKFREDEGFVKEEDDKVLPENEFKKQIWLLF
EYPESSSPARIIAIVSVLVILISIVIFCLETLPEFRDEKELILTQNLENVNETLLQSGGY
TIFNDPFFIIETVCIIWFSFEFTVRCFACPSKAAFFKNIMNIIDIVSILPYFITLGTDLA
QQQGSNGQQAMSFAILRIIRLVRVFRIFKLSRHSKGLQILGHTLRASMRELGLLIFFLFI
GVILFSSAVYFAEADEAATHFQSIPDAFWWAVVTMTTVGYGDMKPITVGGKIVGSLCAIA
GVLTIALPVPVIVSNFNYFYHRETDNEEQTQLTQNAVSCPYLPTIIKKFRSSSSSSTEDK
SEYLEMEEGIKESLCVKEKKCQVTGNGNETAKQNCVNAKSVETDV
Download sequence
Identical sequences ENSACAP00000001834

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]