SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000001890 from Anolis carolinensis 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000001890
Domain Number 1 Region: 162-276
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 8.9e-38
Family Spermadhesin, CUB domain 0.0004
Further Details:      
 
Domain Number 2 Region: 6-114
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.31e-34
Family Spermadhesin, CUB domain 0.00029
Further Details:      
 
Domain Number 3 Region: 331-444
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 4.58e-28
Family Frizzled cysteine-rich domain 0.00034
Further Details:      
 
Domain Number 4 Region: 286-319
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000249
Family LDL receptor-like module 0.002
Further Details:      
 
Domain Number 5 Region: 120-157
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000471
Family LDL receptor-like module 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000001890   Gene: ENSACAG00000001980   Transcript: ENSACAT00000001936
Sequence length 445
Comment pep:novel scaffold:AnoCar2.0:GL343797.1:1526:15972:1 gene:ENSACAG00000001980 transcript:ENSACAT00000001936 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SPLAVCGGNLHGPEGSFSSPNYPSPYPPNVLCKWNIQVSEGMVVQLKVDVLDVESSASCL
YDRLEVYKEHEGTSLWFCGTVAPATINTNSSRLHVVFVSDESIAPSGFTAHYHAVLPSEK
NCSWDEFSCDQGLCLLPTSVCDGYNNCHDRTDEGNCTTKHKDCGGTLTSMEGRFFSPNYP
QPYPHLQLCLWHISVPLGHVIDLHFHNFSLESQEECNYDFVEVYDSAGMGATSIMGRFCN
SNMPPVLTSSQHVMTILFVADEGIADSGFFATYRAYNATESRNMWTLEFACRNGECQAER
LVCDGWHDCPDRSDELNCTTISYPSFTTEPSCEPIEVEMCLGLSYNTTSFPNIWLAIPDQ
QGAEEILQDYMMLKDLACYPHLRLFICSLFVPKCTPDGGILQPCRSICLGTEQRCQQSLS
FLGVPWPLNCNVLPDSSDPSECFMP
Download sequence
Identical sequences H9G5T8
ENSACAP00000001890 ENSACAP00000001890

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]