SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000002463 from Anolis carolinensis 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000002463
Domain Number 1 Region: 210-438
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.62e-53
Family Voltage-gated potassium channels 0.00085
Further Details:      
 
Domain Number 2 Region: 53-167
Classification Level Classification E-value
Superfamily POZ domain 2.88e-28
Family Tetramerization domain of potassium channels 0.00065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000002463   Gene: ENSACAG00000002558   Transcript: ENSACAT00000002526
Sequence length 506
Comment pep:novel chromosome:AnoCar2.0:4:10590335:10597868:1 gene:ENSACAG00000002558 transcript:ENSACAT00000002526 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKSPPCCMSLSSGASVEELDESTSLGSFESSVFCSEEEPVSLLPKVAPLLDCITINVGGA
RFVLSQEKLCCYPDTRLGKLAVVVSATRDVASSLLDLCDDANLVENEYFFDRSSQAFSYI
HNYYQTGRLHVMDQLCAVSFLQEIQYWGLDELSIDSCCRDRYFRRKELSESLDIKNDTEE
LDAHNEEEDFSGSLCPRFRHKLWEILEKPGSSIAARTFGTISMAFVIISIANMALISVEL
SWLPQHSLEILEHICIAWFTGEFILRFLCAWNRCRFIRRVANIIDLLAILPFYITLIVES
LRGRHSSQELENMGRIVQVLRLLRGLRMLKLGRHSTGLRSLAMTIAQCYEEVGMLLLFLS
VGISIFSTVEYFAEQGIPGTTFTSVPCAWWWATTSMTTVGYGDIRPDTTAGKIIAFMCIL
SGILVLALPIAIINDRFSACYFTLKIKEAAIQQREALKKLTKNMSSDSNISINLRDVYAR
SVMDVLRLKGRERTSTRSSGGDEYWF
Download sequence
Identical sequences G1KAW2
ENSACAP00000002463 ENSACAP00000002463 XP_003219466.1.98722

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]