SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000003056 from Anolis carolinensis 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000003056
Domain Number 1 Region: 211-454
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 4e-55
Family Voltage-gated potassium channels 0.0011
Further Details:      
 
Domain Number 2 Region: 52-164
Classification Level Classification E-value
Superfamily POZ domain 1.33e-25
Family Tetramerization domain of potassium channels 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000003056   Gene: ENSACAG00000003138   Transcript: ENSACAT00000003134
Sequence length 488
Comment pep:novel chromosome:AnoCar2.0:2:51207806:51218359:1 gene:ENSACAG00000003138 transcript:ENSACAT00000003134 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NYYSFEDEEEEEEEEEEEEDEEDQPRLSPVFPFSPSFHSEAATTTAASSSVLNINVGGRT
YRLTYQAVAIYPNTRLGRLATSTDRRCQLGLCDDYAAQGDEYFFDRDPAVFQLIYNFYAS
GVLQVRDELCPRSFLEELSYWGVRLKYTPRCCRICFEERRDELNEQLKVQRELQAQAAVQ
ESEHLFRHMRYAAQRWRLWNLMEKPFSSTMAKAMGVASSFFVLISVVALALNTVEEMQQK
NKVNGVIQPMLEHVETFCIAFFTLEYILRLISTPDLRHFVSSALNAVDLIAVLPLYIQLF
LEHFVEDLPRGQGSAHEHDIEKVGRVGKVGQVLRIMRLMRIFRILKLARHSTGLRAFGFT
VRQCYQQVGCLLLFIALGIFAFSAMVYTVEHDVSSTNFTSIPHAWWWAAVSISTVGYGDM
CPETHLGRLFAFLCIAFGIILNGMPISVLYNKFSDYYTKLKAYEYTSIRKDRGKVNFTRR
AVKKMSEC
Download sequence
Identical sequences ENSACAP00000003056

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]