SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000003826 from Anolis carolinensis 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000003826
Domain Number 1 Region: 221-461
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.49e-48
Family Voltage-gated potassium channels 0.0011
Further Details:      
 
Domain Number 2 Region: 64-171
Classification Level Classification E-value
Superfamily POZ domain 4.71e-28
Family Tetramerization domain of potassium channels 0.00042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000003826   Gene: ENSACAG00000003934   Transcript: ENSACAT00000003918
Sequence length 509
Comment pep:novel scaffold:AnoCar2.0:GL343226.1:1982506:1985712:1 gene:ENSACAG00000003934 transcript:ENSACAT00000003918 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTLLPGENSDYDYSALSCASDASFNHPFFAETETLKGVFYQRAKLIHPGEDLYECIHPED
RKHHIIINVGGFKYLLPWTTLDEFPMTRLGQLKFCNNFDDILNICDDYDVTCNEFFFDRN
PGAFRTILTFLRAGKLRLLREMCALSFQEELLYWGIEENSLEWCCKRKYLQKMEEFAELN
ETEDEFIDSENQSDAVVETKAGLCMKKLQDMVERPQSGIPGKVFACLSVIFVTITAVNLS
ISTMPGLREEEERGECSQMCYNIFIVESVCVGWFSLEFILRFIQAPSKFVFLRNPLTMID
IVAILPYYITLFLDTASLGSNKKPSSGNIYLDKVGLVLRILRALRILYVMRLARHSLGLQ
TLGLTARRCTREFGLLLLFLCVAIALFSPLLYVIENEMTGSQEFSSIPASYWWAVITMTT
VGYGDMVPRSIPGQVVALSSILSGILLMAFPVTSIFHTFSRSYIELKQEQERIMYRRAQF
LMKSKSELSHASQGSDVFPSASSETREHD
Download sequence
Identical sequences H9G896
28377.ENSACAP00000003826 ENSACAP00000003826 ENSACAP00000003826 XP_003224038.1.98722 XP_008113811.1.98722

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]