SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000005520 from Anolis carolinensis 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000005520
Domain Number 1 Region: 91-366
Classification Level Classification E-value
Superfamily Mitochondrial carrier 2.09e-80
Family Mitochondrial carrier 0.0000305
Further Details:      
 
Domain Number 2 Region: 1-86
Classification Level Classification E-value
Superfamily EF-hand 0.0000000189
Family Polcalcin 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000005520   Gene: ENSACAG00000005628   Transcript: ENSACAT00000005641
Sequence length 374
Comment pep:novel scaffold:AnoCar2.0:GL343211.1:2359272:2379699:1 gene:ENSACAG00000005628 transcript:ENSACAT00000005641 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GKIDASEIGQSLKILGIDISEKQATRILQRILSMDADGTMSVDWNEWRDHFLFNPATDIQ
GIIRYWKHSTVLDIGDSLTIPDEFTEEEKKTGQWWKQLLSGGVAGAVSRTGTAPLDRLKV
MMQVHGSKGKMNIAGGLQQMVKEGGVRSLWRGNGVNVVKIAPETAIKFWAYERYKKMFVD
EDGKIGTMQRFISGSLAGATAQTSIYPMEVLKTRLAVGKTGQYSGMFDCAKKILRKEGVM
AFYKGYIPNILGIIPYAGIDLAVYEALKKTWLEKYATDSANPGVLVLLGCGTLSSTCGQL
ASYPLALIRTRMQAQAMVDGGPQLNMVALFQRIIAQEGPLGLYRGIAPNFMKVLPAVSIS
YVVYEKMKENLGIA
Download sequence
Identical sequences H9GAF2
ENSACAP00000005520 ENSACAP00000005520

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]