SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000006471 from Anolis carolinensis 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000006471
Domain Number 1 Region: 499-556
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.6e-21
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 2 Region: 541-593
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.52e-20
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 3 Region: 460-513
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000275
Family Classic zinc finger, C2H2 0.017
Further Details:      
 
Domain Number 4 Region: 140-191
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.000000000000144
Family KRAB domain (Kruppel-associated box) 0.0034
Further Details:      
 
Weak hits

Sequence:  ENSACAP00000006471
Domain Number - Region: 34-123
Classification Level Classification E-value
Superfamily Tropomyosin 0.000157
Family Tropomyosin 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000006471   Gene: ENSACAG00000006602   Transcript: ENSACAT00000006616
Sequence length 614
Comment pep:novel scaffold:AnoCar2.0:GL343332.1:1103615:1109661:-1 gene:ENSACAG00000006602 transcript:ENSACAT00000006616 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALLFLQIQEWNVEAQHLMPLQPPLVPELSHMREAQLHTAEASLWSVVATVQAMERKIDL
LATRLLSLEGRSGTAEKKLLDCEKTAMEFGNQLESKWAVLGTLIQEYGLLQRRLENMENL
LKNRNFWVLRLPPGTKGEIPKMPVTFVDIAVYFSAEEWKNLADWQKDIYNNLVKENYESL
LNSGVDVNISKPESHPRVERGADQHVSEQQITTKEREVPAEPCPGETMCSHIYCPQIICK
HLWGEHMMEWLGGPSKSLEKPMMSAPDMLTRIKQEEPFVGGGHFPEERGIPSDPCAGAEA
LMSAHDFLSWIKQEEEPCVREHWESAERDILTGPGTGEEPCLAFRNPSFFPSLYSPYRKA
QHQKNQCFSRPHSIPMVLKSLSYTEDKERGVSGDGMAVKAEEQRRCPEEPARPRESMFQG
EAPPAAGAGGTMEAYAGQCGPVSQPLSPARSRPAQGPADRPHGCNECGKMFGVKKSLKVH
QRSHHGQERPYECTECQKSFNCHSGLVRHQMTHRGERPYKCEECGKCYSRKEHLQNHQRL
HTGERPFQCPVCGKRFIRKQNLLKHQRIHTGERPYQCAECGRSFRYKESLKDHLRTHSAE
PPTPRLLPSLGGDS
Download sequence
Identical sequences H9GBP3
ENSACAP00000006471 ENSACAP00000006471

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]