SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000006589 from Anolis carolinensis 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000006589
Domain Number 1 Region: 59-110
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000143
Family Classic zinc finger, C2H2 0.026
Further Details:      
 
Domain Number 2 Region: 592-647
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000186
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 3 Region: 325-370
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000423
Family Classic zinc finger, C2H2 0.0025
Further Details:      
 
Domain Number 4 Region: 374-402
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000246
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 5 Region: 465-491
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000567
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 6 Region: 655-680
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000678
Family Classic zinc finger, C2H2 0.027
Further Details:      
 
Domain Number 7 Region: 418-456
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000309
Family Classic zinc finger, C2H2 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000006589   Gene: ENSACAG00000006612   Transcript: ENSACAT00000006735
Sequence length 778
Comment pep:novel chromosome:AnoCar2.0:4:155870205:155916991:1 gene:ENSACAG00000006612 transcript:ENSACAT00000006735 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADSYSYRVGKKVAGSSKASMDKESSKAEMKLNPAYEQSRLGNATNDKTEGKRKGRPKVD
SQALKDIPLPLMNQWKDEFKAHSRVKCPNSGCWLEFPSIYGLKYHYQRCQGSAVVEKRTF
PCPYCEATFTSKTQLEKHHLWNHLERRLPVVSPPPVENKVPKASSKSGSKKRAAEGSASP
TIHPKQAKMEKAMAIQRPENGECAPVKQRNKEFQVTVSGVAATPLTQPSSGRGSKQQSSR
KVVVEQEEDPERMKHRRKQKTPKKFTGEQPSISGTFGLKGLAKAEDKAKAHRAKKLEAAL
NSNNNNEEQKKKLLGSSMKKEASSHLHLVSPEEQWQRIINEKGEIACPTCNMISRKTVLG
LKKHMEVCQKLQDALKCQHCKKQFKSKAGLNYHTMAEHVNKPPPVEAAVPLTEHEERERL
RKVLKQMGKLKCPNEGCAATFSSLMGFQYHQKRCGKQPSEVEKPLFTCPHCGKTYKSKAG
HDYHLRSEHPSPVEPNAMTQCSFFLYGKSNRIKVWVGMSYVFKTGLSQPPEKQEIKAESN
PMEDFERTPSGRIRRTSAQVAVFHLQEIAEDELAKDWTKRRMKDDLVPETKRLNYTRPGL
PKLNPRLLETWKNEVKEKGHINCPNNCCAAIYSSVSGLKAHLANCNKGDHSVGKYRCLLC
QKEFSSESGVKYHIIKTHSENWFRTSTEAIRKKKDSGEHSPPGSEGKKQSTDGKKRGRKP
KERPPEFPLKIKEITPGKTNHKKSTGLWQTVDCSPDGRERGNKPSQSKKGGPSKMPEK
Download sequence
Identical sequences G1KFN9
ENSACAP00000006589 ENSACAP00000006589

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]