SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000007468 from Anolis carolinensis 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000007468
Domain Number 1 Region: 37-504
Classification Level Classification E-value
Superfamily Sema domain 2.09e-131
Family Sema domain 0.0000216
Further Details:      
 
Domain Number 2 Region: 1343-1469,1664-1853
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.16e-52
Family p120GAP domain-like 0.032
Further Details:      
 
Domain Number 3 Region: 1036-1140
Classification Level Classification E-value
Superfamily E set domains 1.53e-16
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.062
Further Details:      
 
Domain Number 4 Region: 949-1036
Classification Level Classification E-value
Superfamily E set domains 3.44e-16
Family Other IPT/TIG domains 0.018
Further Details:      
 
Domain Number 5 Region: 852-950
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000299
Family Other IPT/TIG domains 0.0089
Further Details:      
 
Domain Number 6 Region: 507-559
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000114
Family Plexin repeat 0.0019
Further Details:      
 
Domain Number 7 Region: 806-838
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000392
Family Plexin repeat 0.0028
Further Details:      
 
Domain Number 8 Region: 1155-1212
Classification Level Classification E-value
Superfamily E set domains 0.0000784
Family E-set domains of sugar-utilizing enzymes 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000007468   Gene: ENSACAG00000007544   Transcript: ENSACAT00000007625
Sequence length 1883
Comment pep:novel chromosome:AnoCar2.0:2:166830388:167150556:1 gene:ENSACAG00000007544 transcript:ENSACAT00000007625 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LRLKPHLSVSIWTLVLLGNAWLPLSEGTPKSSSPFRTFQVTDWSLTHLVVHNKTGEVYVG
AINRIYKLASNLTLMRTHVTGPVDDNEKCYPPPSVQSCPHGLVSTNNVNKLLLVDYSGNR
LIACGSASQGICQFLRLDDLFKLGEPHHRKEHYLSSVNESGTMSGVIIEVQNGQNKLFIG
TPIDGKSEYFPTLSSRKLMDSEENAEMFGFVYQDEFVSSQLKIPSDTLSKFPTFDIYYIY
SFSSEQFVYYLTLQLDTQLTSPDSTGEQFFTSKVVRLCVDDPKFYSYVEFPIGCVRDGTE
YRLIQDAYLSKPGKALARQLGISEDEDILFTVFSQGQKNRVKPPKESVLCLFTLKKIKDK
IKERIQSCYRGEGKLSLPWLLNKELGCINSPLQIDDNFCGQDFNQPLGGTVPIEGMPLFV
DKEDGMTSVAAYDYRGHTVVFAGTRSGKIKKILVDSGNPIGRAALQYENVVAHEGSSILR
DLVLSPDLQYLYAMTEKQVTRVPVESCEQYTTCARCLGSRDPHCGWCVLHNICSRKDRCE
RADEPQRFASDLRQCVQLTVQPKNISVTMSEVPLVLQAWNVPDLSAGVNCSFEDFTESES
RIDDGRIYCSSPSAKDVIPITRGQGDKRVVKLYLKSKETGKKFAAVDFVFYNCSVHQSCL
SCVNGSFPCHWCKYRHICTHNAADCSFQEGRVNMSEDCPQILPSTQIYIPVGVVKPITLT
AKNLPQPQSGQRNYECIFHIPGSPTRVTALRFNSTSIQCQNTSYFYEGNDISDLPVNLSV
VWNGNFIIDNPQNIQAHLYKCSALRESCGLCLKADPRFECGWCVSEKRCSLRQHCPASES
SWMHASNGNSRCADPKITKLFPETGPRQGGTRLTIIGENLGLKFEDVRSGVWVGKVICIP
IESEYISAEQIVCEIGEASPSKTQDAPVEVCVKDCSPSYKAVAPKSFTFVTPTFSQVIPA
RGPLSGGTWISIKGKHLNAGSDIAVTIGGQQCTFSWRNAGEIRCRTPPGQVPGESPILIH
INRAILSSPDVMYYYTEDPTIQKIDPEWSINSGGTLLTVTGTNLATIKEPRIRAKYGNAE
AENNCTVHNDTTMVCYAPSIDNPVRSPPELGDRPDEIGFVMDNVQALLIINKTNFVYYPD
PVFEPLPSGMLELKPSSPLILKGRNLVPPASGNSRLNYTVLIGDTPCALTVSETQLLCES
PNLTGQHKVTVNCVRHSPCLCFCSFNSLFLVPAFFILKGKENLILLIIIIVLIAYKRKSR
DAERTLKRLQLQMQLGSRVALECKEAFAELQTDIHELTNDLDGAGIPFLDYRTYAMRVLF
PGIEDHPVLKEMEVQANVEKSLTLFGQLLNKKHFLLTFIRTLEAQRSFSMRDRGNVASLI
MTALQGEMEYATGVLKQLLSDLIEKNLESKNHPKLLLRRTESVAEKMLTNWFTFLLYKFL
KECAGEPLFMLYCAIKQQMEKGPIDAITGEARYSLSEDKLIRQQIDYKMLTLNCVNPENE
NAPEIPVKVLNCDTITQVKEKLLDAVYKGVPYSQRPKAGDMDLEWRQGRMARIILQDEDV
TTKIDNDWKRLNTLAHYQVTDGSSVALVPKQNSAYNISNSSTFTKSLSRYESMLRTASSP
DSLRSRTPMITPDLESGTKLWHLVKNHDHMDQREGDRGSKMVSEIYLTRLLATKGTLQKF
VDDLFETIFSTAHRGSALPLAIKYMFDFLDEQADKHQINDYDVRHTWKSNCLPLRFWVNV
IKNPQFVFDIHKNSITDACLSVVAQTFMDSCSTSEHKLGKDSPSNKLLYAKDIPNYKSWV
ERYYADIAKMPAISDQDMSAYLAEQSRLHLSQFNSMSALHEIYSYITKYKDEILAALEKD
EQARRQRLRSKLEQAIDTMALSS
Download sequence
Identical sequences ENSACAP00000007468

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]