SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000007578 from Anolis carolinensis 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000007578
Domain Number 1 Region: 396-503
Classification Level Classification E-value
Superfamily PDZ domain-like 5.78e-28
Family PDZ domain 0.0052
Further Details:      
 
Domain Number 2 Region: 146-243
Classification Level Classification E-value
Superfamily PDZ domain-like 6.97e-25
Family PDZ domain 0.0071
Further Details:      
 
Domain Number 3 Region: 2506-2597
Classification Level Classification E-value
Superfamily PDZ domain-like 1.22e-23
Family Interleukin 16 0.0036
Further Details:      
 
Domain Number 4 Region: 542-640
Classification Level Classification E-value
Superfamily PDZ domain-like 7.23e-19
Family PDZ domain 0.01
Further Details:      
 
Domain Number 5 Region: 2366-2464
Classification Level Classification E-value
Superfamily PDZ domain-like 1.25e-18
Family Interleukin 16 0.0016
Further Details:      
 
Domain Number 6 Region: 954-1031
Classification Level Classification E-value
Superfamily PDZ domain-like 0.0000000000789
Family PDZ domain 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000007578   Gene: ENSACAG00000007750   Transcript: ENSACAT00000007739
Sequence length 2600
Comment pep:novel scaffold:AnoCar2.0:GL343335.1:521005:598374:1 gene:ENSACAG00000007750 transcript:ENSACAT00000007739 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SYLADQCWNGGFIYLIMLRRIKRKAPLPPANGNNSNSSSSSEPKARPTSEPSGKSTQNGK
RTRKFGVITRTSPSSKESKGSKGSPKTEPENGHCTLMDTDRLHPDRSKMESRGDDLLQKM
DSPFLAGQYRSRLSDGGILDLNSSELSLQREGCRIWKMAMMKGADGLGIQITGGRGSKRS
PHAIIIARVEEGGSAHRDGRLKVGDELLMINGQSLVGLSHQDAVALLRSAEGLTYLVVAS
REGAEEDFLNYPSTSLPDLISTCSAQDATPWTDNKENEEPEKEEEDAKGSSIERNVPDTD
KSPDPSGEEGSKENGESPTRGGGILKYRSRSQGAATRLESVGEDDELTVENGDVNYEIAM
KYSRGGRKHSLPQHLDTGTRQEYPIVKKSTRSLSAAQVEYPWRLTQPSIISNIVLMKGQG
KGLGFSIVGGQDSARGRMGIFVKTIFPNGAAAADGRLKEGDELLEVNGETLQGLTHQEAI
KTFKQLKKGVVTLTVRTRLRSPSLTPARTLLSRSGKPSSSSSGGASLSGSEDGDASSVSR
KGPGPKDRIVMDVTLNKEPGVGLGIGVCCLTMENSSPGIYIHSLAPGSVAMIDGRLSRGD
QILEADSVSLRHAALSEAYAVLRERSPGPVHLIISRHPNPKVSEQEMDEAIAQTTQREHK
DAASSHSTGTGLFSPYSFHQGSANSEAEHSQYSLQDGASHLPLSETTAAGSSDEEPLHPK
GGSSFLDGSILSSGIPTTKESSLCDSPASGSNSPGPFNKPKETITRHVTFSDSPKGARIV
QRQRRIAFYDGDVSDEDDFTKQDGIRLQKGLRSKGQKKAEGSCDVIITTTPAEDTDENLE
KDFATHGFNDSAHSSFKDLTQGAMEHIVDSPFLPVKSFDHSNVPEVHPSHLSLKDFREAQ
GESKRSPKLEHKAVTRVKSLMSIEYHGISRQKNEDHGACSRPSGRVLPHIRKSEPQENPF
GQSDIETVTLIRNENESFGLDLEICATPLRVVITNLRPGGVAERTSGGKLVPGDEIVAIN
SFPIHGFSYEEPNHLCPENFPKIQQELDEFNKQEMELDVCMVNSIGRQKAQYKLPPVKDS
GVGFTQNPKMLGQKASKRQTLCILLQPIETHLEHLKSLGLSLLEPLQFTCWVAVIYIVQP
WADVRLGSQKTSKPGMHKLWPSRNRLSNTVESSETDGTVQNDPSNVLIFEEENSFTNQEE
PLCGDNLKNAAERTVLPSDAKMKEMLAHSLETSCVQGSSCAQDSSRDIDGFLEEMNSSKE
KEATCLLASDKCAMEDIFIMAEDAGSNSVSNIVKKELPGRTLNYASNTQELLGFSALDSI
DASKIFTLNQTRLSNYSRNFSNLKDDTLTGVEDKSSTVPKSMYAAADDSSSDTESVVETA
GLSGNSSLLLSACDNSSKTYKTLESDEEQIEICCSNLEQQHFPQKELVTPPSETSSPPEC
HSSDTVLQEEGNVEIGSLAISDVKLSLEEQPFHSPSQVSPPRADLLEHNNGECSFYKSSS
LRSGDRVSLESREQLTETCETSKLDAEEMPLHSTKNINGWERRNEHDKKEQLPIENDLGI
NCGSHMVAYSSATKKGITDSVHLTKQDSHSVDCTSQRIVNNSRSPLMTKSKDFSKAITAN
DLPGKNEKNATPVSKSSNAKIQTSGQCKGNTIPHNPSSFKKMHQETRGIPQKSIVETLSN
NQRNKPGPKLKGLTIKSKSKTHSDSLSAAPAKGGVTDQKKTSIPVQSSPRLLPKKVTSLH
NLATHLEPLSRSLSMGCKILQQEEENKLVLALPQESSSAMLNGGGNTVQNNKDKSINNLV
LGDAEMAEYPTEQKEKQVPIQLAMNSKERNKTDAANYQSREGSSQIKAHSQMATRGHCLS
GKTENQGMDMSCLNSDGCTNNPPGSDNTGPFKKESLGVLSPAQKEQSGQEIQRTFIEVRL
SSSSSSLTPEGSLEKGESNKKVINQLESEVQNCSQNTFEAAHFHNALKPVTRTYSMPTHL
SNHLREESSAIDAPMHHVQNILNSVSCEQHPNSELGMLKIVHLNLMNDQNIQDEKEVSNS
IPKSNSQELSLPNDNSSRIVDKLKTCRRNYYYYELNWPHDPLSSFSVKQRIKSFENLANF
DRPMVKAIDIHSTSFSSKLPVGRRLSGGVSAVSAASVNDAVQTLRRSLSSYCENEAPGSP
QMTKSSTTAALMHLQQTSPESSKDDIQLEKNARHDTLGSPENLPLSSTNIRRSRASGGHI
RHTPLSRSKLRELRALSMPDLDKLCCEDFTTDSQTSQFKTELEVPPAARSLGLPIESVPS
LKDYSELSGLVMASRHHSKESSPRNSGSGTPGSTSDEDVRQHDVSRRKSWSISLDQLLVS
TLDQQKLQSVLSLVTTKCDVSSLLQEARTQAKNKEDVYFVVLNKEEGSGLGFSVAGGVDL
EQKSIIVHRVFSKGVASQEGIIHRGDLILSINGICLTGSVHGDVLNALHQARLHKYAIVV
IRKERDGKKSSSGSEKSTPTGPTSGAATMGGGTGFFSLSKGLGGELSDAIYVELLKTSAG
LGFSLDGGKASISGDRPLLIKRIFKGGAAEQDGKLEVGDEILAIGGKSLLGLMHYDAWNI
IKSVPEGPVQLLIRKHQPSA
Download sequence
Identical sequences ENSACAP00000007578

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]