SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000010318 from Anolis carolinensis 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000010318
Domain Number 1 Region: 343-415
Classification Level Classification E-value
Superfamily RING/U-box 7.07e-22
Family RING finger domain, C3HC4 0.025
Further Details:      
 
Domain Number 2 Region: 634-709
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.07e-20
Family SPRY domain 0.00082
Further Details:      
 
Domain Number 3 Region: 16-89
Classification Level Classification E-value
Superfamily RING/U-box 6.24e-18
Family RING finger domain, C3HC4 0.0051
Further Details:      
 
Domain Number 4 Region: 431-487
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000000672
Family B-box zinc-binding domain 0.0014
Further Details:      
 
Domain Number 5 Region: 95-150
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000000717
Family B-box zinc-binding domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000010318   Gene: ENSACAG00000010521   Transcript: ENSACAT00000010530
Sequence length 709
Comment pep:novel chromosome:AnoCar2.0:2:194939815:194967387:1 gene:ENSACAG00000010521 transcript:ENSACAT00000010530 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AKCLPTMASPVSVVDLKEDALCPLCKQYLTDPVLVDCDHNFCRICISDYYVSKKEKNEPL
QCPVCSSPIQEGKLRPNQQLGSIVEKLKKLPALKVGKDYVCPKHKEKLNLFCEDDEELVC
LICERSPEHASHTVHLAEQAVEKYKNIFRKDNKNLFAKKKSELENILRKLRKTQKRAYWV
KMVEKEKEKAAAEFKNFHGFLDEQQNLLLTQMQELQKEVARKRKHYVSSLSEEMTSLTKL
IAEIQETCEQPATEFLMQFSKTSTRSYFLGMSYFRGFITASFSLNQGGDLALLCLICKSR
TSLGGNLVVDGNTKRKIVRAPTDFSTTHSKEETMAGVSGGSVQDLCEEATCSVCLDYFRD
PVTLAECGHNFCRACLGRWWGDSEKEAFCPQCRLTLQSRDVIPNRPLANFVEITKKLSLQ
GPRGAGAMGGVCGEHQEPFKFFCKEHQRPICVVCDRAKEHREHTVIPLQEAAQEYQDQIC
NCLKNLKEDKEKFLASKAAIEKESQDLLNETEVEREKVMSAFRELHHFLEDQEKRLLVQM
EEIEKEIIRKRKEHLARFSREISFLGSLIQEMEEKLHQEASESLQDIGRILKKCPLIWAS
TKPRMFSKSATTLFRTLMLQMILLFFHFLIFSLQISIVNVTLDRDTAFPRLVLSEDLKCV
RWDQKYQNLPENPGRFNLSSFVLGREEFSAGRYFWDVSVGSEERWAVGV
Download sequence
Identical sequences ENSACAP00000010318

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]