SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000010551 from Anolis carolinensis 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000010551
Domain Number 1 Region: 417-870
Classification Level Classification E-value
Superfamily Ribonuclease H-like 7.59e-130
Family PIWI domain 0.013
Further Details:      
 
Domain Number 2 Region: 128-439
Classification Level Classification E-value
Superfamily PAZ domain 6.08e-75
Family PAZ domain 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000010551   Gene: ENSACAG00000010657   Transcript: ENSACAT00000010769
Sequence length 870
Comment pep:novel scaffold:AnoCar2.0:GL343443.1:190926:208491:1 gene:ENSACAG00000010657 transcript:ENSACAT00000010769 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LGRGFLGRGVASIDTKVVAKPQDAHTQLRAGPAGDSKIEGAVWGSGMVPCHGRGDMASLG
HIRAAVEPDRTCAAPSASITGVLQPAALDQPSPETPTAVFDEHTEKREPLIKQGSSGTTA
PLALNVIKIHCQNDAVYQYHVTFSPEVECKSMRFGMLKEHKSVTGDVTAFDGYILYLPLR
LPPNEDLKCQRKTDGVEVTIKIQMTKILEPSSDLCIPFYNVVFRRVMRILDMKLVGRNFF
DPTSASVLQQYRLQIWPGYAASIRRTDGGLFLLADVVHKVVRNDSVLDFMHAVYQQSQGN
FQDECTKQLIGDIILTRYNNNTYRIDDIDWNKTPKDSFTLSNGKETTFIDYYSKNYGITI
KDLDQPLLIHRPKEKKNPPGKLQRGEILLVPELSFLTGIPERMKKDFRIMKELSQQINLS
PKQHHISLRQLLNRIQKNEDAHNELSRWGLRLDNDICKANGRVLPLERINLKKTTFTTSE
DLNWTKAVTREACISAIPIRYWALFYPKRTREQATELFTMLHKISGPLDIPLTPPIWSEL
KDDRIETYARAIKSLLSSENTIQLVVCIITGTRDDLYGAIKKLCCVQSPVPSQVINARTI
TTQPAKLRSIAQKILLQINCKLGGELWSVDIPLKQLMMIGMDVYHDPGRGKRSVVGFVAS
TNHTLTQWYSKVVFQMPHQEMVDSLKVCLVGALQKFYEVNHFLPEKIVFYRDGVSDSQIK
MVENYEVPQLQKCFEAFHNYNPKMVVFVVQKKISVNIYSAATDNFTTPAPGTVIDHMITS
RDWVDFYLMAHSPRQGCGVPTRYICVLNTANLSPDHMQRLTFKLCHMYWNWPGTIRVPAP
CKYAHKLAFLSGQVLHHEPAIELYEKLFFL
Download sequence
Identical sequences ENSACAP00000010551

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]