SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000010689 from Anolis carolinensis 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000010689
Domain Number 1 Region: 206-296
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000806
Family I set domains 0.0068
Further Details:      
 
Domain Number 2 Region: 15-52,163-208
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000249
Family I set domains 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000010689   Gene: ENSACAG00000010900   Transcript: ENSACAT00000010910
Sequence length 327
Comment pep:novel scaffold:AnoCar2.0:GL344239.1:40530:66449:1 gene:ENSACAG00000010900 transcript:ENSACAT00000010910 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LAPPTSISVIAADTPAPFSRYQAQNFTLVCIVSGGKPAPMVYFKRDGELIEVVPLMEPPL
NAAGLQEGRSSRNLFREADDTKMHRSLSLLNGEERGGRPSTEQPSKGLTPEQGLLFSPAT
EVMPETVVSREFPRWIQNMEPVYYFHHTHIPISDGTVEVRAILMWTLNPQIDNEALFSCE
VKHPALSMSMQSEVTLVAPKGPKITMTPTRARVGDTVRILVQGFQNEVFPEPMFTWTRVG
SRLLDGSTEHDGKELVLERVPAELNGSMYRCTAQNPLGSTDTHTRLIVFENPNIPRGAED
SNGSTSANPNHFRILLAFILTVTLEMT
Download sequence
Identical sequences ENSACAP00000010689

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]