SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000010833 from Anolis carolinensis 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000010833
Domain Number 1 Region: 383-835
Classification Level Classification E-value
Superfamily Ribonuclease H-like 5.06e-130
Family PIWI domain 0.0026
Further Details:      
 
Domain Number 2 Region: 84-405
Classification Level Classification E-value
Superfamily PAZ domain 3.92e-85
Family PAZ domain 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000010833   Gene: ENSACAG00000010879   Transcript: ENSACAT00000011057
Sequence length 835
Comment pep:novel scaffold:AnoCar2.0:GL343538.1:146357:158169:1 gene:ENSACAG00000010879 transcript:ENSACAT00000011057 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RPGQQPPQPEPPAEGPLIGRGRQRGGGLPAQGPPKELEISAGFQEMSLGERGGYRRNYND
IGVYTRQSMEHVKEAKTGVSGTAIALSTNHFRLTSRPQWTLYQYHIDFSPPMESRRLRCA
LLFQHEDILGRTHAFDGTILFLPKKVGNKVTEVYSQTRQGETVKITITLTNELPSTSPTC
LQFYNIIFRRVLKIMNLQQIGRNYYNPSDPISVPKHRHRLMVWPGFTTSILQYETSVMLC
SDVSHKVLRSETVLDFMYSLYEQVGEQRFKEACAKELVGLIVLTRYNNKTYRVDDISWDS
SPKDRFKKADGSEISFVDYYQMQYNQEVKDLNQPLLLSQPKRKRGPGGAVPGPAALVPEL
CFLTGLTDKMRSDFSVMKDLAVHTRLAPEQRMREIGKLVDYINKDANVQQELRDWGLSFD
SNLLSFSGRVVQSERIHQGGKVFDYNPQAADWSRETRGAPLMRAKPLDNWLLLFPRRNYD
AANALVQNLFKVTPAMGIQMKKATMVEVEDRTEAYLRALKQTVTSDTQMVVCLLSSSRKD
KYDTIKKFLCSDCPTPSQCVLARTLGKAQTVMAVATKIALQMNCKMGGELWSVEVPLKQL
MVVGIDCYHDTSAGRRSIAAFVASLNQGMTRWYSRCVLQDRGQEVVDGLKVCFQAALRTW
YTHNQHLPSRIIVYRDGVGDGQLKTLVSYEVPQFLECLKTIGQDYSPKLTVIVVKKRLNN
RFFARIDGRLQNPPPGTVVDVEVTRPEWYDFFIVSQSVKCGTVAPTHYNVIYDSSALKPD
HMQRLTYKLCHMYYNWPGVIRVPAPCQYAHKLAFLVGQSIHREPNLALAENLYYL
Download sequence
Identical sequences ENSACAP00000010833

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]