SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000012475 from Anolis carolinensis 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000012475
Domain Number 1 Region: 253-340,550-587
Classification Level Classification E-value
Superfamily Inhibitor of apoptosis (IAP) repeat 3.27e-46
Family Inhibitor of apoptosis (IAP) repeat 0.00000893
Further Details:      
 
Domain Number 2 Region: 168-243
Classification Level Classification E-value
Superfamily Inhibitor of apoptosis (IAP) repeat 8.11e-31
Family Inhibitor of apoptosis (IAP) repeat 0.0000912
Further Details:      
 
Domain Number 3 Region: 23-108
Classification Level Classification E-value
Superfamily Inhibitor of apoptosis (IAP) repeat 6.02e-28
Family Inhibitor of apoptosis (IAP) repeat 0.00041
Further Details:      
 
Domain Number 4 Region: 452-544
Classification Level Classification E-value
Superfamily DEATH domain 1.32e-20
Family Caspase recruitment domain, CARD 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000012475   Gene: ENSACAG00000012650   Transcript: ENSACAT00000012731
Sequence length 612
Comment pep:novel chromosome:AnoCar2.0:3:192311974:192322685:-1 gene:ENSACAG00000012650 transcript:ENSACAT00000012731 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LIIMNTFDTFAAKLKNVPDVGQLKYDLSCELFRMSTFSTFPLHVPVSERSLARAGFYYTG
VKDKVKCYSCGLMLDNWKKGDNPLDKHKQLYPSCSVVQNLTSLNNLGSSFYSAFSPPSLS
VGHSSSHSPQQTPNLDQVGYFSGSFSSVPQELPKLTEGISHVRPKVANSAMSSEEARLLT
FKTWPLTFLSPSSLAKAGFYYIGPADKVACFVCGGHLGNWEPKDNAMSEHRRHFPTCPFV
EQTQSQPGFTVSNLSMQTYRARVGTFENWPMTVPVLPQRLADAGFYYVGRNDDVKCFCCD
GGLRCWESGDDPWEEHAKWFPRCEYLIHRKGQEFVRCVQARFPHLLEQLLSTSDIPVDEN
TSPPIVIRFEPGENGSEDEVIMKTPVVEAALEMGFRRRLVKQIVQSKILRTGESYKSIND
LVSDLIAADDEKRDDEKEPQMEESTSDYCIPDLSLIRKNRVALFQRLTCVLPILECLLAS
KAISSLEYQVIKQKTQTPLQARELIDTILVKGNKAANIFRNCIQESDPVLYQDLFVEKNM
TYIPADVSGLSMEEQLRRLQEERTCKVCMDKEVSIVFIPCGHLVVCKECAPSLRKCPICR
GTIKGTVRTFLS
Download sequence
Identical sequences ENSACAP00000012475

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]