SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000013820 from Anolis carolinensis 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000013820
Domain Number 1 Region: 428-881
Classification Level Classification E-value
Superfamily Ribonuclease H-like 1.09e-108
Family PIWI domain 0.0045
Further Details:      
 
Domain Number 2 Region: 130-448
Classification Level Classification E-value
Superfamily PAZ domain 1.73e-73
Family PAZ domain 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000013820   Gene: ENSACAG00000014070   Transcript: ENSACAT00000014102
Sequence length 881
Comment pep:novel chromosome:AnoCar2.0:3:195760499:195811877:-1 gene:ENSACAG00000014070 transcript:ENSACAT00000014102 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGRARAKARGVYRGEGTLEQPGSPRATLGTGNQFFPEQPTSRDRKYMSKCNSGPLALES
GRDDGSSHTRAGNSPPKSLQVGFSAGSAGYKVMDRGGKIRCNFSDMGVNTREKMEHVRDS
KTGSSGIPVKVVTNLFGLSMPREWQLYQYHVKFNPELESKRLKAALVYNHPVFKGKPVVF
DGVSTLFLAHKQENEVTELFCETQRGETVKIIITLTHQLQSSSPVSIQFLNVTFKKVLKK
LSMHQIGQNFYSPSDPVEIPQHKLTLWPGFAVSVGQYENRVMVCADVSHKVLRNESVLEF
MTSLYQNVDRARFPEMCEKELVGLIVLTRYNNKTYRIDDIEWSVKATDSFEKRDGTQITY
EQYYKQQYDLVLTDLNQPMLVSELKKGRNIDKPRVVHLVPELCYMTGLSSRAKSNFHLMK
DLAQEMHLSPETRHQRLSRLADNIQRNKDARLELENWDCSLDAMIPSFMENILEGKVFLK
SILILQCMPMNAGDWLRDMRNMKIIRVARLENWMVVCTHRNMDMTHDLVNCLRRVGGPMG
FHIEYPRVVQVPDSPLAFVRVLQQNVNPEQQLVLCVLPSDQKDCYDSVKKFVSLEQPIPS
QCVLARTLSKQRMMMSVATKMALQIACKLGGELWAVEIPLKSLMVVGIDVNKDAVAKGTS
VVGFVASTNASITRIRWYSHCVIQKAGTMTADCLKVCMEGAINKWQTCNGELPARVIVYR
DGIGNGQLRMVVDYEVPQLLSVLNECSGGFRRPKLSVVIVRKQTLCRFFTEANRNLQNPP
VGTVIDTEATRPEWYDFFLISQNARQGSVNPTYYNVIYDDNGLKPDHMQRLTYKLCHLYF
NWTGLIRVPAPCQYASKLTFLVGQSIHREPSLELADKLYYL
Download sequence
Identical sequences G1KPG4
ENSACAP00000013820 ENSACAP00000013820

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]