SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000016857 from Anolis carolinensis 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000016857
Domain Number 1 Region: 230-295
Classification Level Classification E-value
Superfamily XPC-binding domain 6.28e-22
Family XPC-binding domain 0.0000391
Further Details:      
 
Domain Number 2 Region: 4-88
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.82e-21
Family Ubiquitin-related 0.0000261
Further Details:      
 
Domain Number 3 Region: 305-363
Classification Level Classification E-value
Superfamily UBA-like 0.000000000000141
Family UBA domain 0.00035
Further Details:      
 
Domain Number 4 Region: 153-207
Classification Level Classification E-value
Superfamily UBA-like 0.00000000000022
Family UBA domain 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000016857   Gene: ENSACAG00000017106   Transcript: ENSACAT00000017192
Sequence length 365
Comment pep:novel chromosome:AnoCar2.0:2:77788848:77806285:1 gene:ENSACAG00000017106 transcript:ENSACAT00000017192 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AMAVTVTLKTLQQQTFKIRMEPEETVRVLKEKIEAEKGKDSFPVSGQKLIYAGKILSDDV
PIKEYKIDEKNFVVVMVTKNKAGSGAPAPLPSEATSTSEPAPSSGQTQLPTTAAASPPPA
APSGEEKPPEEPVTVSPQESIVSSIPPSGSMGREDDAASTLVTGSEYETMLTEIMSMGYE
RERVVAALRASYNNPHRAVEYLLTGIPGSPEPERGPIQESQPQEQPVPEGENPLEFLRDQ
PQFQNMRQVIQQNPALLPALLQQLGQENPQLLQQISQHQEQFIQMLNEPLGEMADIADIE
GEMGAIGEEAPQMNYIQVTPQEKEAIERLKALGFPESLVIQAYFACEKNENLAANFLLSQ
NFDDE
Download sequence
Identical sequences G1KTK0
ENSACAP00000016857 28377.ENSACAP00000016857 ENSACAP00000016857

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]