SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000019067 from Anolis carolinensis 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000019067
Domain Number 1 Region: 73-164
Classification Level Classification E-value
Superfamily Virus ectodomain 4.56e-23
Family Virus ectodomain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000019067   Gene: ENSACAG00000022813   Transcript: ENSACAT00000023149
Sequence length 220
Comment pep:novel chromosome:AnoCar2.0:1:107001168:107001845:-1 gene:ENSACAG00000022813 transcript:ENSACAT00000023149 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LPPGYFWICGKWGGKVLPPLWVGTCTIGTLVPTNIGIHPREQPLHALEAADRWNRPKRSY
DEKRGYDPEGERFATILFPSLGVALNVKQLRRLSAQLEILANQTVIGMKALQTEIDSLAG
VLMQHKMALDYLLAAEGGLCIWLNTTCCHYVNESGLIESDVAKINTVVSTIRATYTPKGT
GWFDWLFSWLPNLNWLRDLVKVLFIILLIILLALLFLPCI
Download sequence
Identical sequences G1KZ42
ENSACAP00000019067 ENSACAP00000020725 ENSACAP00000021393 ENSACAP00000019067 ENSACAP00000020725 ENSACAP00000021393

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]