SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000019215 from Anolis carolinensis 69_2.0

(show help)
Strong hits

Sequence:	ENSACAP00000019215
Domain Number 1	Region: 182-242
Classification Level	Classification	E-value
Superfamily	beta-beta-alpha zinc fingers	1.53e-16
Family	Classic zinc finger, C2H2	0.009
Further Details:

Domain Number 2	Region: 240-292
Classification Level	Classification	E-value
Superfamily	beta-beta-alpha zinc fingers	0.0000000000000184
Family	Classic zinc finger, C2H2	0.0089
Further Details:

Domain Number 3	Region: 156-204
Classification Level	Classification	E-value
Superfamily	beta-beta-alpha zinc fingers	0.000000000000206
Family	Classic zinc finger, C2H2	0.0052
Further Details:

Domain Number 4	Region: 2-44
Classification Level	Classification	E-value
Superfamily	KRAB domain (Kruppel-associated box)	0.000000000000798
Family	KRAB domain (Kruppel-associated box)	0.0026
Further Details:

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by

Cellular Component	IC (bits)	H-Score

Biological Process	IC (bits)	H-Score

Molecular Function	IC (bits)	H-Score

External link(s)	Protein: ENSACAP00000019215 Gene: ENSACAG00000024957 Transcript: ENSACAT00000025522
Sequence length	296
Comment	pep:novel contig::AAWZ02036887:17450:20480:-1 gene:ENSACAG00000024957 transcript:ENSACAT00000025522 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence	VNIEDVSVHFSKEEWTLLDRHQQALHWEVMGENYKMLASFVFLYKLHTNTQTIQSFFCSF SMSYHNNSLSPKGPGVAVCGVHKGYLCSAQYHKIASTARKGTRKMQCAADTREIQIQETV DENQIEKAQPECHQLEESYGSSTHLTNCENPPIVNKTYKCLDCGKCLSRKGSLNRHQISH TGAKPYKCLECGKGFVDKRSFIGHEMNHRGDNPYKCPECGKGFIHKRSLFQHEMNHRGEK PYSCLKCEKSFSRKAVLKRHQDRHMEEKSHTCLECGKSFQWRVNLKTHEKTHIGER
Download sequence
Identical sequences	H9GS45 ENSACAP00000019215 ENSACAP00000019215

SEARCH