SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000019243 from Anolis carolinensis 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000019243
Domain Number 1 Region: 434-602
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.74e-55
Family SPRY domain 0.0000916
Further Details:      
 
Domain Number 2 Region: 13-51,183-215
Classification Level Classification E-value
Superfamily RING/U-box 1.62e-17
Family RING finger domain, C3HC4 0.016
Further Details:      
 
Domain Number 3 Region: 224-279
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 1.98e-17
Family B-box zinc-binding domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000019243   Gene: ENSACAG00000025111   Transcript: ENSACAT00000024488
Sequence length 608
Comment pep:novel chromosome:AnoCar2.0:2:188794430:188807675:-1 gene:ENSACAG00000025111 transcript:ENSACAT00000024488 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SASHGGPLNPVTNLHEEAVCAICLDYFIDPVSIGCGHNFCRVCITQLWGSGEGQVEEEEG
DDGEASGSDGGYGPGSEVGIDDGDLGPEEDADDEEDDLEDEFLDDGDMEDEREDLSRDEY
DGDDAEDVWDDEEDRDYWDQDPGSDEMCSYDEEDDIMDEDEEPEEDAEYTVPATPPMPPQ
RQAFTCPQCRKTFPRRSFRPNLQLANMVEIIRRMHPQPYSKAQSVERSICEKHQEPLKLF
CETDEEPICVVCRESRAHKHHSVMPLEEVVQEYKKKLNSRVFGSLKKKLGVCFKAKSKEE
EKITDLKNKMKLDMKEFESDFERLHQFLVGEQALLLHQLEDRYDILLARQSSNVTHLEEQ
EAALGRLIAEAEDKSKQDGLQLLKDFKGTLVRCENIKFHDPEMVAVDAGKKYQNYFLIDV
LMKKMEKVFSKAPRVDLTLDPETAHPRLTLSSDSRGVRLGGRWRDVPDSPKRFDSDYCVL
ALQGFTCGRHYWEVEVGGRRGWAVGAARESARRKEKASAGGPYQKREIWCVGTNGKKYQA
LSTTEQMPLSPCERLRRFCVYLDYERGQLGFYNAENMTHIHTFNASFRERIFPFFRILSK
GTRIKICT
Download sequence
Identical sequences G1KWD0
ENSACAP00000019243 ENSACAP00000019243

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]