SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000019669 from Anolis carolinensis 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000019669
Domain Number 1 Region: 4-114
Classification Level Classification E-value
Superfamily EF-hand 4.54e-25
Family Calmodulin-like 0.025
Further Details:      
 
Domain Number 2 Region: 138-169
Classification Level Classification E-value
Superfamily Mitochondrial carrier 0.000000484
Family Mitochondrial carrier 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000019669   Gene: ENSACAG00000023604   Transcript: ENSACAT00000026052
Sequence length 169
Comment pep:novel chromosome:AnoCar2.0:2:76324542:76352071:1 gene:ENSACAG00000023604 transcript:ENSACAT00000026052 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PSCLQDILRVGDTDHDGQLNFEEFARYLQERERKLLLMFHSLDRNNDGQIDVSEIQQTFH
GLGVYISLLQAEKILHSIDKDGTMTIDWHEWRDHFILNPLENMEEIVHYWKHSTVLDIGE
CLTVPDEFSEKEKKTGMWWKQLIAGAMAGAVSRTGTAPLDRLKVFMQVN
Download sequence
Identical sequences ENSACAP00000019669

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]