SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000020789 from Anolis carolinensis 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000020789
Domain Number 1 Region: 49-127
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000029
Family I set domains 0.067
Further Details:      
 
Domain Number 2 Region: 275-362
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000012
Family I set domains 0.073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000020789   Gene: ENSACAG00000007626   Transcript: ENSACAT00000022819
Sequence length 421
Comment pep:novel chromosome:AnoCar2.0:6:64340096:64343752:1 gene:ENSACAG00000007626 transcript:ENSACAT00000022819 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AGLIVIAILFSSTGILNAFDIMEKEDVFKRTPCPAFLMFENAAYLAEMSFELPCNCKPEE
VSSVVWYFQKGMGSQQTKVLTDFDGTMVVDSTHIKVGMDMLRRFSIRMFSLIVFRVQVED
SGHYICGTKKGDFFYGYDVDVQASKRISVAFTDENQHPNKDKEEKHYKIFTVFWDWTRCN
RCDVRGEQRRIGLCYIKSSHLIRRYRTATAEVASCGSESIPKQFKRVIKNRKPEIVIRSC
SVPCIRKTTASEGEESISDVISQIGEMPWVSNIPIQFHKQRLGTDLIISCPGARPEHAVA
WDKDSTRLYLTRFLTGVNKSMRVFIDYGNHLHIRFAQLSDRGIYFCWREGELVAGFRLTV
MYESRRQRSFDDPEAQYAIKTIFIFYILLTFIFVTVHGVRFCMYAFKMRRNFSPKSESKG
V
Download sequence
Identical sequences G1KYC2
ENSACAP00000020789 ENSACAP00000020789

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]