SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000021349 from Anolis carolinensis 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000021349
Domain Number 1 Region: 109-168
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 7.45e-18
Family KRAB domain (Kruppel-associated box) 0.0024
Further Details:      
 
Domain Number 2 Region: 488-538
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.97e-16
Family Classic zinc finger, C2H2 0.0028
Further Details:      
 
Domain Number 3 Region: 424-476
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000386
Family Classic zinc finger, C2H2 0.0045
Further Details:      
 
Domain Number 4 Region: 375-435
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000096
Family Classic zinc finger, C2H2 0.017
Further Details:      
 
Weak hits

Sequence:  ENSACAP00000021349
Domain Number - Region: 19-93
Classification Level Classification E-value
Superfamily Tropomyosin 0.00118
Family Tropomyosin 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000021349   Gene: ENSACAG00000027554   Transcript: ENSACAT00000024894
Sequence length 540
Comment pep:novel contig::AAWZ02037767:3896:10675:-1 gene:ENSACAG00000027554 transcript:ENSACAT00000024894 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DGEGSGAGPSSSSSSSLWTVVGALQAVERKVDLQAGRLLGLERRAGSAEKRLSGAEKALA
ECGHHLSALRTLAQEYMLLRRRMENMENLLKNRDLWILRLPPGPKAADPKAPVTVDEVSV
YFSKPEWEKLEEWQRELYKNVMKGNYESLVSMDYAIAKPELLSRIERGEEPCAEDRGLSE
EEEAVREVGTGESGDELERTRLNAMEPWENYNFQGSIALGHGGSMSHLRNHNNNNLLRNS
NNNTNKCHLEQLELAQCIGTMGLVVRVEKWDAAERRSLADNNPVIITGLSTLKRGSLWSD
SFPFPSAEDAPFSHSPPEAETGTGDVVIYSTLPDEEEDEEEGEDLVVGPSAEEDPPQRAP
DFGDFTTIIVQEGALPGEAPFVCPECGKSFLYEEQRELHRRTHPRIPAGERPIRSEILPP
PTPKVYPCPECERCFPHPSSLSKHRLWHSGERPHTCGECQKSFRLKINLHLHQRSHAASS
SAAKAGSYICGECGRGFNHHSNFLRHQMIHTGERPYSCAECGKTFIRKEHLATHRRLHTG
Download sequence
Identical sequences H9GVH7
ENSACAP00000021349 ENSACAP00000021349

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]