SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for sgtc|cn03158 from Cryptococcus neoformans B-3501A

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  sgtc|cn03158
Domain Number - Region: 308-362
Classification Level Classification E-value
Superfamily Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 0.0876
Family Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) sgtc|cn03158
Sequence length 475
Comment CNBC1540 chr03.b3501.040506 (428542..429127, 429183..429274, 429324..429472, 429527..429656, 429712..430047, 430110..430244)
Sequence
MSSPALDTIHDQTGEQDLHQEVQAQEHLPVEPTPEVQEEPESDHQDDDEQPEAQVLEQEQ
EQVAEQERLQDQEDQDQGAELVSQQPTAEEQEETRDELYNEVFGNQGSEASDLSDDEDVR
MDEGEKYVPATATSAAKIPKFKKSKRDDEDEDEDEDEDEDDGGERRRKKKKRAERRRQRQ
EEEDEDEAPVLDEATQRRLALEERIDAIGKKPKAIRRKKKGDDDVDIVDSYHDDICARLR
DRMIAAADKDEAANRIKMPGTAKLAMLDEVMGVLRNTTLWQSIVDNGVLEAVKRWLEPLP
DKSLPSVGIQKAIFEVLPKMDLDTTTLKECRLGPIVLFYTKTKRVTPAINRQADALVQAW
SRPIIKRPANYRSRYIESQNEVEQSQGGGGTGGGYSQSQRGPGERKFKRFDVKKALEENA
HRKGARLQIVQDVQYTVAPEPKTHHHAEEMQHVSRIQQDNKKFNRFARQVKTKKH
Download sequence
Identical sequences P0CO38 P0CO39
XP_569780.1.95466 XP_776662.1.65578 179.m00495 214684.CNC05650 sgtc|cn03158

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]